THE STRUCTURE OF KBP.K FROM E. COLI
MGLFNFVKDA GEKLWDAVTG QHDKDDQAKK VQEHLNKTGI PDADKVNIQI ADGKATVTGD GLSQEAKEKI LVAVGNISGI ASVDDQVKTA TPATASQFYT VKSGDTLSAI SKQVYGNANL YNKIFEANKP MLKSPDKIYP GQVLRIPEEL EHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.0 % (1686 of 1794) | 93.5 % (870 of 930) | 94.5 % (657 of 695) | 94.1 % (159 of 169) |
Backbone | 95.5 % (888 of 930) | 93.8 % (300 of 320) | 97.4 % (447 of 459) | 93.4 % (141 of 151) |
Sidechain | 93.1 % (939 of 1009) | 93.4 % (570 of 610) | 92.1 % (351 of 381) | 100.0 % (18 of 18) |
Aromatic | 70.7 % (82 of 116) | 70.7 % (41 of 58) | 70.2 % (40 of 57) | 100.0 % (1 of 1) |
Methyl | 98.9 % (174 of 176) | 98.9 % (87 of 88) | 98.9 % (87 of 88) |
1. YgaU
MGLFNFVKDA GEKLWDAVTG QHDKDDQAKK VQEHLNKTGI PDADKVNIQI ADGKATVTGD GLSQEAKEKI LVAVGNISGI ASVDDQVKTA TPATASQFYT VKSGDTLSAI SKQVYGNANL YNKIFEANKP MLKSPDKIYP GQVLRIPEEL EHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.400
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | YgaU | [U-99% 13C; U-99% 15N] | 1.0 mM | |
2 | KCl | natural abundance | 5.0 mM | |
3 | NaPi | natural abundance | 20.0 mM | |
4 | NaCl | natural abundance | 50.0 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr25839_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| || VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEH...HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
113 | GLN | CD | 179.877 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 930 | 881 | 94.7 |
13C chemical shifts | 695 | 657 | 94.5 |
15N chemical shifts | 170 | 160 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 305 | 95.3 |
13C chemical shifts | 314 | 306 | 97.5 |
15N chemical shifts | 151 | 141 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 610 | 576 | 94.4 |
13C chemical shifts | 381 | 351 | 92.1 |
15N chemical shifts | 19 | 19 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 90 | 90 | 100.0 |
13C chemical shifts | 90 | 89 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 41 | 70.7 |
13C chemical shifts | 57 | 40 | 70.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Spectral peak lists
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||||||||||||||||||| |||||||||||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||| |||||||| ..LFNFVKDAGEKLWDAVTGQ.DKDDQAKKVQEHLNKTGI.DADKVNIQIA.GKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||||||||||||| ||||||||||| |||| |||| |||||| ||||| | VKS.DTLSAISKQVYGN.NLYNKIFEANK.MLKS.DKIY.GQVLRI.EELEH....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||| |||| | | | |||||||||||| | |||||||| |||||||||| |||||||||||||| ||||||||||||| |||||||| ...FNFVKDAGEKLW..VTGQ.D.D.Q.KKVQEHLNKTGI.D.DKVNIQIA.GKATVTGDGL.QEAKEKILVAVGNI.GIASVDDQVKTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||| ||||||||| |||||| |||| ||| |||| ||| || |||| | VKS.DTL.AISKQVYGN.NLYNKI.EANK.MLK..DKIY.GQV.RI.EELE.....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||||||||||||||||||||||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||| |||||||| ..LFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGI.DADKVNIQIA.GKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||||||||||||| ||||||||||| |||| |||| |||||| ||||| | VKS.DTLSAISKQVYGN.NLYNKIFEANK.MLKS.DKIY.GQVLRI.EELEH....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| || VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEH...HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| || VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEH...HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||||| |||| |||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ..LFNFVKDAGEKLWD.VTGQ.DKDDQAKKVQEHLNKTGI.DADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||||||||||||| |||||||||||||||| |||| |||||||||||| || VKS.DTLSAISKQVYGN.NLYNKIFEANKPMLKS.DKIY.GQVLRIPEELEH...HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||||||||||||||||||||||||||||| |||||||||| ||||||||||||||||||||||||||||||||||||||| |||||||| ..LFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGI.DADKVNIQIA.GKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||||||||||||||||||||||||| |||| |||| |||||||||||| | VKS.DTLSAISKQVYGNANLYNKIFEANK.MLKS.DKIY.GQVLRIPEELEH....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||||||||||||||||| |||||||||||||||||||||||||||||||||| | VKSGDTLSAISKQVYGN.NLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEH....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||||||||||||||||||| |||||||||||||||||| |||||||||| |||||||||||||||||||||| ||||||||||| |||| |||||||| ..LFNFVKDAGEKLWDAVTGQ.DKDDQAKKVQEHLNKTGI.DADKVNIQIA.GKATVTGDGLSQEAKEKILVAV.NISGIASVDDQ.KTAT.ATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| ||||||||||||| ||||||||||| |||| |||| |||||| ||||| | VKS.DTLSAISKQVYGN.NLYNKIFEANK.MLKS.DKIY.GQVLRI.EELEH....H
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||||||||| ||| || ||||||||||||||||||||||||||||| ||||| ||| |||||||||||| || ||||||||||||||||||||| ..LFNFVKDAGEKL..AVT.QH.KDDQAKKVQEHLNKTGIPDADKVNIQIAD.KATVT.DGL.QEAKEKILVAVG.IS.IASVDDQVKTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH | | ||||||||||| |||||||| |||||||||||||| || |||||| || V.S.DTLSAISKQVY...NLYNKIFE.NKPMLKSPDKIYPG.VL.IPEELE....HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||| ||||||||||| ||| | | ||||||||||| ||| |||||| ||||||||| ||| ||||||||| |||| ||||||||||| |||| | ||| MGLF.FVKDAGEKLWD.VTG.H.K.DQAKKVQEHLN..GIP.ADKVNI.IADGKATVT.DGL.QEAKEKILV.VGNI.GIASVDDQVKT.TPAT.S.FYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH |||| ||||||||||| ||||||||| |||||| | |||||||||||||| || VKSG.TLSAISKQVYG.ANLYNKIFE.NKPMLK.P..IYPGQVLRIPEELE....HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT |||||| | | ||| |||||| |||| || |||||||||| ||||||||||||||||||||||| ||| |||||| ||||||||||||| .GLFNFV..A..K.WDA.TGQHDK..QAKK..EH...TGIPDADKVN..IADGKATVTGDGLSQEAKEKILV...NIS..ASVDDQ.KTATPATASQFYT -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| | |||||||||||||||||||||||||||||||||||||||||||||| || VKS.D.LSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEH...HH
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPATASQFYT ||| || ||||||||| |||| || |||| || || || || |||||||||||| ||| ||||| || .GLF...KD..EKLWDAVTG.HDKD....KV...LNKT..PD..KV..QI.....TV.GDGLSQEAKEKI..........ASV..QVKTA.PA....... -------110-------120-------130-------140-------150------- VKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEELEHHHHHH ||| |||| || ||||| || |||| |||| || || VKS..............ANLY....EA..PMLKS..KI.PGQV.RIPE..EH...HH