Solution NMR Structure of Designed Protein DA05, Northeast Structural Genomics Consortium (NESG) Target OR626
GGSPDENIAK FEKAYKKAEE LNQGELMGRA LYNIGLEKNK MGKVKEAIEY FLRAKKVFDA EHDTDGARRA AKSLSEAYQK VEGSGDKGKI FQKEGESILE GGSPDENIAK FEKAYKKAEE LNQGELMGRA LYNIGLEKNK MGKVKEAIEY FLRAKKVFDA EHDTDGARRA AKSLSEAYQK VEGSGDKGKI FQKEGESILE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 54.9 % (1290 of 2348) | 53.2 % (662 of 1244) | 56.7 % (506 of 892) | 57.5 % (122 of 212) |
Backbone | 57.2 % (684 of 1196) | 56.0 % (235 of 420) | 57.8 % (334 of 578) | 58.1 % (115 of 198) |
Sidechain | 53.8 % (715 of 1330) | 51.8 % (427 of 824) | 57.1 % (281 of 492) | 50.0 % (7 of 14) |
Aromatic | 50.0 % (76 of 152) | 50.0 % (38 of 76) | 50.0 % (38 of 76) | |
Methyl | 57.7 % (97 of 168) | 56.0 % (47 of 84) | 59.5 % (50 of 84) |
1. DA05
GGSPDENIAK FEKAYKKAEE LNQGELMGRA LYNIGLEKNK MGKVKEAIEY FLRAKKVFDA EHDTDGARRA AKSLSEAYQK VEGSGDKGKI FQKEGESILE GGSPDENIAK FEKAYKKAEE LNQGELMGRA LYNIGLEKNK MGKVKEAIEY FLRAKKVFDA EHDTDGARRA AKSLSEAYQK VEGSGDKGKI FQKEGESILESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DA05 | [U-5% 13C; U-15N] | 200 uM | |
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 % | |
11 | PMSF | natural abundance | 0.5 mM | |
12 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DA05 | [U-13C; U-15N] | 600 uM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | PMSF | natural abundance | 0.5 mM | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DA05 | [U-5% 13C; U-15N] | 200 uM | |
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 % | |
11 | PMSF | natural abundance | 0.5 mM | |
12 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DA05 | [U-5% 13C; U-15N] | 200 uM | |
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 % | |
11 | PMSF | natural abundance | 0.5 mM | |
12 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DA05 | [U-5% 13C; U-15N] | 200 uM | |
8 | sodium phosphate | natural abundance | 25 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 % | |
11 | PMSF | natural abundance | 0.5 mM | |
12 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25850_2n8i.nef |
Input source #2: Coordindates | 2n8i.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GGSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GGSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 100 | 0 | 0 | 100.0 |
Content subtype: combined_25850_2n8i.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GGSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
62 | HIS | ND1 | 182.997 |
62 | HIS | NE2 | 175.409 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 622 | 613 | 98.6 |
13C chemical shifts | 446 | 440 | 98.7 |
15N chemical shifts | 110 | 102 | 92.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 206 | 98.1 |
13C chemical shifts | 200 | 195 | 97.5 |
15N chemical shifts | 99 | 95 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 412 | 407 | 98.8 |
13C chemical shifts | 246 | 245 | 99.6 |
15N chemical shifts | 11 | 7 | 63.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 44 | 100.0 |
13C chemical shifts | 44 | 44 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 37 | 97.4 |
13C chemical shifts | 38 | 37 | 97.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GGSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | |||||| ||||| ..SPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEG...K.KIFQKE.ESILE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GGSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKVEGSGDKGKIFQKEGESILE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GSPDENIAKFEKAYKKAEELNQGELMGRALYNIGLEKNKMGKVKEAIEYFLRAKKVFDAEHDTDGARRAAKSLSEAYQKV --------10--------20--------30--------40--------50--------60--------70--------80-