Solution structure of LptE from Pseudomonas Aerigunosa
GTSGFQLRGL GDAQFALKEI DVSARNAYGP TVRELKETLE NSGVKVTSNA PYHLVLVRED NQQRTVSYTG SARGAEFELT NTINYEIVGA NDLVLMSNQV QVQKVYVHDE NNLIGSDQEA AQLRSEMRRD LIQQLSMRLQ ALTPAQLDEA QRQAEAKAKA EAEALR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.2 % (1604 of 1883) | 85.4 % (837 of 980) | 83.6 % (598 of 715) | 89.9 % (169 of 188) |
Backbone | 91.6 % (907 of 990) | 96.2 % (326 of 339) | 86.9 % (424 of 488) | 96.3 % (157 of 163) |
Sidechain | 80.2 % (841 of 1049) | 79.7 % (511 of 641) | 83.0 % (318 of 383) | 48.0 % (12 of 25) |
Aromatic | 73.1 % (57 of 78) | 79.5 % (31 of 39) | 66.7 % (26 of 39) | |
Methyl | 97.0 % (194 of 200) | 99.0 % (99 of 100) | 95.0 % (95 of 100) |
1. entity
GTSGFQLRGL GDAQFALKEI DVSARNAYGP TVRELKETLE NSGVKVTSNA PYHLVLVRED NQQRTVSYTG SARGAEFELT NTINYEIVGA NDLVLMSNQV QVQKVYVHDE NNLIGSDQEA AQLRSEMRRD LIQQLSMRLQ ALTPAQLDEA QRQAEAKAKA EAEALRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.45 mM 15N-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 25 mM | |
3 | CHAPS | natural abundance | 20 mM | |
4 | LptE | 15N-labeled | 0.45 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 2H,15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 25 mM | |
15 | LptE | 2H,15N,13C-labeled | 0.35 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.45 mM 15N-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | sodium chloride | natural abundance | 25 mM | |
3 | CHAPS | natural abundance | 20 mM | |
4 | LptE | 15N-labeled | 0.45 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 2H,15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 25 mM | |
15 | LptE | 2H,15N,13C-labeled | 0.35 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 2H,15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 25 mM | |
15 | LptE | 2H,15N,13C-labeled | 0.35 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 2H,15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 50 mM | |
14 | sodium chloride | natural abundance | 25 mM | |
15 | LptE | 2H,15N,13C-labeled | 0.35 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.5, Details 0.35 mM 15N,13C-labeled LptE
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 25 mM | |
9 | CHAPS | natural abundance | 20 mM | |
10 | LptE | 15N,13C-labeled | 0.35 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25869_2n8x.nef |
Input source #2: Coordindates | 2n8x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 120-------130-------140-------150-------160-------170-------180--- QVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR -------110-------120-------130-------140-------150-------160------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 166 | 0 | 0 | 100.0 |
Content subtype: combined_25869_2n8x.nef
Assigned chemical shifts
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQV ||||||||||||||||||||||| ||||||| ||||||||||||||||||||| ||||||||||||||||||| ||||| || |||||||||||| || .TSGFQLRGLGDAQFALKEIDVSA..AYGPTVR.LKETLENSGVKVTSNAPYHLV.VREDNQQRTVSYTGSARGA.FELTN.IN.EIVGANDLVLMS.QV 120-------130-------140-------150-------160-------170-------180--- QVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR |||| ||| |||||||| ||||||||| |||||||||||||||||||||| |||||| ||| |||| QVQK.YVH.ENNLIGSD.EAAQLRSEM.RDLIQQLSMRLQALTPAQLDEA.RQAEAK.KAE.EALR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 980 | 763 | 77.9 |
13C chemical shifts | 715 | 547 | 76.5 |
15N chemical shifts | 200 | 150 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 339 | 303 | 89.4 |
13C chemical shifts | 332 | 260 | 78.3 |
15N chemical shifts | 163 | 143 | 87.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 641 | 460 | 71.8 |
13C chemical shifts | 383 | 287 | 74.9 |
15N chemical shifts | 37 | 7 | 18.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 103 | 93 | 90.3 |
13C chemical shifts | 103 | 88 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 24 | 61.5 |
13C chemical shifts | 39 | 18 | 46.2 |
Distance restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQV |||||||||||||||||||||||| ||| ||| ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| .TSGFQLRGLGDAQFALKEIDVSAR.AYG.TVR.LKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGA.FELTNTINYEIVGANDLVLMSNQV 120-------130-------140-------150-------160-------170-------180--- QVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||| QVQKVYVHDENNLIGSDQEAAQLRSEM.RDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR
Dihedral angle restraints
--20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- GTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQV |||||||||| |||||||||||||||||||||||| ||||||||||| ||||||||||||||||||||||||||| ...............ALKEIDVSAR.AYGPTVRELKETLENSGVKVTSNA.......REDNQQRTVSY.....GAEFELTNTINYEIVGANDLVLMSNQV --20-------30--------40--------50--------60--------70--------80--------90-------100-------110------- 120-------130-------140-------150-------160-------170-------180--- QVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEALR |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| QVQKVYVHDENN.IGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQRQAEAKAKAEAEAL 120-------130-------140-------150-------160-------170-------180--