ULD complex
GPAMGKPQIL THVIEGFVIQ EGAEPFPVGR SSLLVGNLKG DKRIITDDEI ISLSIEFFDQ NRLDRKVNKD KEKSKEEVND KRYLRCPAAM TVMHLRKFLR SKMDIPNTFQ IDVMYEEEPL KDYYTLMDIA YIYTWRRNGP LPLKYRVRPT CKRMK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 60.5 % (1158 of 1915) | 50.1 % (509 of 1015) | 69.2 % (515 of 744) | 85.9 % (134 of 156) |
Backbone | 88.0 % (801 of 910) | 85.1 % (262 of 308) | 88.8 % (406 of 457) | 91.7 % (133 of 145) |
Sidechain | 41.7 % (480 of 1152) | 34.9 % (247 of 707) | 53.5 % (232 of 434) | 9.1 % (1 of 11) |
Aromatic | 26.5 % (36 of 136) | 29.4 % (20 of 68) | 22.4 % (15 of 67) | 100.0 % (1 of 1) |
Methyl | 83.7 % (134 of 160) | 87.5 % (70 of 80) | 80.0 % (64 of 80) |
1. entity
GPAMGKPQIL THVIEGFVIQ EGAEPFPVGR SSLLVGNLKG DKRIITDDEI ISLSIEFFDQ NRLDRKVNKD KEKSKEEVND KRYLRCPAAM TVMHLRKFLR SKMDIPNTFQ IDVMYEEEPL KDYYTLMDIA YIYTWRRNGP LPLKYRVRPT CKRMKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | bis tris | protons | 3.81 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | bis tris | protons | 3.81 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | bis tris | protons | 3.81 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | bis tris | protons | 3.81 ppm | internal | direct | 1.0 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | TRIS | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25923_2na1.nef |
Input source #2: Coordindates | 2na1.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----30--------40--------50--------60-----------130-------140-------150-------160-------170-------180 GPAMGKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKGDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPAMGKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKGDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------190-------200-------210-------220-------230----- SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMK ||||||||||||||||||||||||||||||||||||||||||||||||||||||| SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMK -------110-------120-------130-------140-------150-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 155 | 0 | 0 | 100.0 |
Content subtype: combined_25923_2na1.nef
Assigned chemical shifts
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- ......PQILTHVIEGFVIQEGAE..PVGRSSLLVGNLKG........................................................DKRI |||||||||||||||||| |||||||||||||| |||| ......PQILTHVIEGFVIQEGAE..PVGRSSLLVGNLKG........................................................DKRI ---130-------140-------150-------160-------170-------180-------190-------200-------210-------220---- ITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR.PAAMTVMHLRKFLRSKMDI.NTFQIDVM....PLKDYYTLMDIAYIYTW.RNGPLPLK ||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| |||||||| ||||||||||||||||| |||||||| ITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR.PAAMTVMHLRKFLRSKMDI.NTFQIDVM....PLKDYYTLMDIAYIYTW.RNGPLPLK ---230----- YRVRPTCKRMK ||||||||||| YRVRPTCKRMK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 744 | 469 | 63.0 |
1H chemical shifts | 1015 | 413 | 40.7 |
15N chemical shifts | 169 | 129 | 76.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 310 | 277 | 89.4 |
1H chemical shifts | 308 | 248 | 80.5 |
15N chemical shifts | 145 | 128 | 88.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 434 | 192 | 44.2 |
1H chemical shifts | 707 | 165 | 23.3 |
15N chemical shifts | 24 | 1 | 4.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 87 | 62 | 71.3 |
1H chemical shifts | 87 | 70 | 80.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 67 | 0 | 0.0 |
1H chemical shifts | 68 | 5 | 7.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
Dihedral angle restraints