BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	41.3 % (229 of 554)	21.4 % (61 of 285)	55.8 % (125 of 224)	95.6 % (43 of 45)
Backbone	79.0 % (207 of 262)	51.1 % (46 of 90)	93.0 % (120 of 129)	95.3 % (41 of 43)
Sidechain	18.0 % (60 of 333)	7.7 % (15 of 195)	31.6 % (43 of 136)	100.0 % (2 of 2)
Aromatic	6.7 % (4 of 60)	6.7 % (2 of 30)	0.0 % (0 of 28)	100.0 % (2 of 2)
Methyl	13.5 % (10 of 74)	13.5 % (5 of 37)	13.5 % (5 of 37)

1. entity

GKRSWDTESV LPMWVLALIV IFLTIAVLLA LRFCGIYGYR LRRK

Show sample condition

Sample

Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H20	natural abundance	93 %
3	D20	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

Protein Blocks Logo

Calculated from 21 models in PDB: 2NA8, Strand ID: A Detail

Release date

2016-07-04

Citation

A Conserved Ectodomain-Transmembrane Domain Linker Motif Tunes the Allosteric Regulation of Cell Surface Receptors
Schmidt, T., Ye, F., Situ, A.J., An, W., Ginsberg, M.H., Ulmer, T.S.
J. Biol. Chem. (2016), 291, 17536-17546, PubMed 27365391 , DOI 10.1074/jbc.M116.733683 , Abstract

Entries sharing articles BMRB: 1 entries Detail

BMRB: 25932 released on 2016-07-04
Title Transmembrane Structure of the P441A Mutant of the Cytokine Receptor Common Subunit beta

Related entities 1. Cytokine Receptor Common Subunit beta, : 1 : 3 : 6 entities Detail

Interaction partners 1. Cytokine Receptor Common Subunit beta, : 9 interactors Detail

More details for 9 interactors identified by 7 citations

Experiments performed 4 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H20	natural abundance	93 %
3	D20	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

2 3D HNCA

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H20	natural abundance	93 %
3	D20	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

3 3D HNCACB

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H20	natural abundance	93 %
3	D20	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

4 3D quant J correlation

Instrument

Bruker Avance - 700 MHz

Sample

State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H20	natural abundance	93 %
3	D20	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

NMR combined restraints 2 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts	combined_25931_2na8.nef
Input source #2: Coordindates	2na8.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Error

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

430-----440-------450-------460-------470---
GKRSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK
||||||||||||||||||||||||||||||||||||||||||||
GKRSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK
--------10--------20--------30--------40----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	44	0	0	100.0

Content subtype: combined_25931_2na8.nef

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	204		97.7 (chain: A, length: 44)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 97.7%
- Total number of assignments
  - ¹³C chemical shifts: 119
  - ¹H chemical shifts: 43
  - ¹⁵N chemical shifts: 42
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
438	SER	HG	3.776

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	224	119	53.1
¹H chemical shifts	285	42	14.7
¹⁵N chemical shifts	50	42	84.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	88	82	93.2
¹H chemical shifts	90	40	44.4
¹⁵N chemical shifts	43	40	93.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	136	37	27.2
¹H chemical shifts	195	2	1.0
¹⁵N chemical shifts	7	2	28.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	38	3	7.9
¹H chemical shifts	38	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	28	0	0.0
¹H chemical shifts	30	2	6.7
¹⁵N chemical shifts	2	2	100.0

Keywords NBP residue, bicelle, cytokine receptors, transmembrane helix

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.651 seconds)

BMRB: 25931

Sample

Entries sharing articles BMRB: 1 entries Detail

Related entities 1. Cytokine Receptor Common Subunit beta, : 1 : 3 : 6 entities Detail

Interaction partners 1. Cytokine Receptor Common Subunit beta, : 9 interactors Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 2 contents Detail