BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	38.3 % (210 of 549)	16.7 % (47 of 281)	55.0 % (122 of 222)	89.1 % (41 of 46)
Backbone	75.0 % (198 of 264)	44.0 % (40 of 91)	92.2 % (119 of 129)	88.6 % (39 of 44)
Sidechain	15.6 % (51 of 326)	3.7 % (7 of 190)	31.3 % (42 of 134)	100.0 % (2 of 2)
Aromatic	6.7 % (4 of 60)	6.7 % (2 of 30)	0.0 % (0 of 28)	100.0 % (2 of 2)
Methyl	10.5 % (8 of 76)	5.3 % (2 of 38)	15.8 % (6 of 38)

1. entity

GKRSWDTESV LAMWVLALIV IFLTIAVLLA LRFCGIYGYR LRRK

Show sample condition

Sample

Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4, Details 350 mM 1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC), 105 mM 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 10 mM tris(2-carboxyethyl)phosphine (TCEP), 25 mM HEPES NaOH (pH 7.4), 6% D2O, 0.02% NaN3

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H2O	natural abundance	93 %
3	D2O	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine (TCEP)	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

Protein Blocks Logo

Calculated from 21 models in PDB: 2NA9, Strand ID: A Detail

Release date

2016-07-04

Citation

A Conserved Ectodomain-Transmembrane Domain Linker Motif Tunes the Allosteric Regulation of Cell Surface Receptors
Schmidt, T., Ye, F., Situ, A.J., An, W., Ginsberg, M.H., Ulmer, T.S.
J. Biol. Chem. (2016), 291, 17536-17546, PubMed 27365391 , DOI 10.1074/jbc.M116.733683 , Abstract

Related entities 1. P441A Mutant of the Cytokine Receptor Common Subunit beta, : 1 : 3 : 5 entities Detail

Interaction partners 1. P441A Mutant of the Cytokine Receptor Common Subunit beta, : 9 interactors Detail

More details for 9 interactors identified by 7 citations

Experiments performed 4 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4, Details 350 mM 1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC), 105 mM 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 10 mM tris(2-carboxyethyl)phosphine (TCEP), 25 mM HEPES NaOH (pH 7.4), 6% D2O, 0.02% NaN3

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H2O	natural abundance	93 %
3	D2O	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine (TCEP)	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

2 3D HNCA

Instrument

Bruker Avance - 700 MHz

Sample

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H2O	natural abundance	93 %
3	D2O	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine (TCEP)	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

3 3D HNCACB

Instrument

Bruker Avance - 700 MHz

Sample

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H2O	natural abundance	93 %
3	D2O	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine (TCEP)	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

4 3D quant J correlation

Instrument

Bruker Avance - 700 MHz

Sample

State anisotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 313 K, pH 7.4, Details 350 mM 1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC), 105 mM 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 10 mM tris(2-carboxyethyl)phosphine (TCEP), 25 mM HEPES NaOH (pH 7.4), 6% D2O, 0.02% NaN3

#	Name	Isotope labeling	Concentration
1	entity	[U-99% 13C; U-99% 15N; 80% 2H]	0.5 mM
2	H2O	natural abundance	93 %
3	D2O	natural abundance	6 %
4	1,2-dihexanoyl-sn-glycero-3-phosphocholine (DHPC)	natural abundance	350 mM
5	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC)	natural abundance	105 mM
6	tris(2-carboxyethyl)phosphine (TCEP)	natural abundance	10 mM
7	HEPES NaOH	natural abundance	25 mM
8	NaN3	natural abundance	0.02 %

NMR combined restraints 2 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts	combined_25932_2na9.nef
Input source #2: Coordindates	2na9.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Error

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

430-----440-------450-------460-------470---
GKRSWDTESVLAMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK
||||||||||||||||||||||||||||||||||||||||||||
GKRSWDTESVLAMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK
--------10--------20--------30--------40----

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	44	0	0	100.0

Content subtype: combined_25932_2na9.nef

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	202		93.2 (chain: A, length: 44)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 44, Sequence coverage: 93.2%
- Total number of assignments
  - ¹³C chemical shifts: 119
  - ¹H chemical shifts: 42
  - ¹⁵N chemical shifts: 41
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
438	SER	HG	3.856

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	222	119	53.6
¹H chemical shifts	281	41	14.6
¹⁵N chemical shifts	51	41	80.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	88	80	90.9
¹H chemical shifts	91	39	42.9
¹⁵N chemical shifts	44	39	88.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	134	39	29.1
¹H chemical shifts	190	2	1.1
¹⁵N chemical shifts	7	2	28.6

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	39	4	10.3
¹H chemical shifts	39	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹³C chemical shifts	28	0	0.0
¹H chemical shifts	30	2	6.7
¹⁵N chemical shifts	2	2	100.0

Keywords NBP residue, bicelle, cytokine receptors, transmembrane helix

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.646 seconds)

BMRB: 25932

Sample

Related entities 1. P441A Mutant of the Cytokine Receptor Common Subunit beta, : 1 : 3 : 5 entities Detail

Interaction partners 1. P441A Mutant of the Cytokine Receptor Common Subunit beta, : 9 interactors Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 2 contents Detail