NSD1-PHD_5-C5HCH tandem domain structure
GAMEREDECF SCGDAGQLVS CKKPGCPKVY HADCLNLTKR PAGKWECPWH QCDVCGKEAA SFCEMCPSSF CKQHREGMLF ISKLDGRLSC TEHD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.1 % (989 of 1051) | 94.9 % (524 of 552) | 92.3 % (373 of 404) | 96.8 % (92 of 95) |
Backbone | 95.8 % (531 of 554) | 96.3 % (184 of 191) | 94.5 % (259 of 274) | 98.9 % (88 of 89) |
Sidechain | 92.8 % (541 of 583) | 94.2 % (340 of 361) | 91.2 % (197 of 216) | 66.7 % (4 of 6) |
Aromatic | 89.8 % (79 of 88) | 100.0 % (44 of 44) | 78.6 % (33 of 42) | 100.0 % (2 of 2) |
Methyl | 94.6 % (53 of 56) | 92.9 % (26 of 28) | 96.4 % (27 of 28) |
1. entity 1
GAMEREDECF SCGDAGQLVS CKKPGCPKVY HADCLNLTKR PAGKWECPWH QCDVCGKEAA SFCEMCPSSF CKQHREGMLF ISKLDGRLSC TEHDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.3 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-99% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity_1 | natural abundance | 0.3 mM | |
11 | D2O | natural abundance | 100 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-99% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
13 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.3 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity_1 | natural abundance | 0.3 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | natural abundance | 0.3 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | entity_1 | natural abundance | 0.3 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
13 | D2O | natural abundance | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-99% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-99% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 295 K, pH 6.3
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-99% 13C; U-99% 15N] | 0.3 mM | |
13 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_25933_2naa.nef |
Input source #2: Coordindates | 2naa.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:93:HIS:NE2 | 2:4:ZN:ZN | unknown | unknown | n/a |
1:50:HIS:NE2 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:74:HIS:ND1 | 2:3:ZN:ZN | unknown | unknown | n/a |
1:31:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:21:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:66:CYS:SG | 2:4:ZN:ZN | unknown | unknown | n/a |
1:26:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:63:CYS:SG | 2:4:ZN:ZN | unknown | unknown | n/a |
1:52:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:71:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:47:CYS:SG | 2:2:ZN:ZN | unknown | unknown | n/a |
1:9:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:12:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:55:CYS:SG | 2:3:ZN:ZN | unknown | unknown | n/a |
1:90:CYS:SG | 2:4:ZN:ZN | unknown | unknown | n/a |
1:34:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
B | 3 | ZN | ZINC ION | None |
B | 4 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_25933_2naa.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
31 | HIS | HE2 | 11.309 |
31 | HIS | NE2 | 168.006 |
61 | SER | HG | 1.421 |
68 | SER | HG | 4.301 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 404 | 366 | 90.6 |
1H chemical shifts | 552 | 522 | 94.6 |
15N chemical shifts | 99 | 92 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 188 | 176 | 93.6 |
1H chemical shifts | 191 | 188 | 98.4 |
15N chemical shifts | 89 | 88 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 216 | 190 | 88.0 |
1H chemical shifts | 361 | 334 | 92.5 |
15N chemical shifts | 10 | 4 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 31 | 28 | 90.3 |
1H chemical shifts | 31 | 27 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 42 | 29 | 69.0 |
1H chemical shifts | 44 | 44 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- GAMEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHD |||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||| ......DECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECPWHQCDVCG...ASF......SFCKQHREGMLFISKLDGRLSCTEHD
RDC restraints