Solution structure of V26A mutant of Ubiquitin at pH 2.0
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.8 % (713 of 905) | 70.0 % (333 of 476) | 88.8 % (309 of 348) | 87.7 % (71 of 81) |
Backbone | 94.2 % (424 of 450) | 93.5 % (145 of 155) | 93.7 % (208 of 222) | 97.3 % (71 of 73) |
Sidechain | 67.2 % (353 of 525) | 58.3 % (187 of 321) | 84.7 % (166 of 196) | 0.0 % (0 of 8) |
Aromatic | 0.0 % (0 of 32) | 0.0 % (0 of 16) | 0.0 % (0 of 16) | |
Methyl | 83.3 % (80 of 96) | 77.1 % (37 of 48) | 89.6 % (43 of 48) |
1. entity
MQIFVKTLTG KTITLEVEPS DTIENAKAKI QDKEGIPPDQ QRLIFAGKQL EDGRTLSDYN IQKESTLHLV LRLRGGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz Bruker Avance III HD
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 2.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ubiquitin | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25973_2nbe.nef |
Input source #2: Coordindates | 2nbe.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------ MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 76 | 0 | 0 | 100.0 |
Content subtype: combined_25973_2nbe.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------ MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGI.PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 476 | 321 | 67.4 |
13C chemical shifts | 348 | 302 | 86.8 |
15N chemical shifts | 85 | 71 | 83.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 155 | 143 | 92.3 |
13C chemical shifts | 152 | 140 | 92.1 |
15N chemical shifts | 73 | 71 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 321 | 178 | 55.5 |
13C chemical shifts | 196 | 162 | 82.7 |
15N chemical shifts | 12 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 37 | 75.5 |
13C chemical shifts | 49 | 44 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 0 | 0.0 |
13C chemical shifts | 16 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------ MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG --------10--------20--------30--------40--------50--------60--------70-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------ MQIFVKTLTGKTITLEVEPSDTIENAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG ||||||||||||||||| |||||||||||||||| |||||||| |||||||||||||| ||||||||||| .QIFVKTLTGKTITLEVE..DTIENAKAKIQDKEGI.PDQQRLIF....LEDGRTLSDYNIQK.STLHLVLRLRG --------10--------20--------30--------40--------50--------60--------70-----