Structure and Dynamics of the Geobacillus stearothermophilus IF2 G3-subdomain
GSHMLDHLLE MILLVSEMEE LKANPNRRAV GTVIEAKLDK GRGPVATLLV QAGTLKVGDP IVVGTTYGRV RAMVNDSGRR VKEAGPSMPV EITGLHDVPQ AGDRFMVFED EKKARQIGEA RAQRQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.8 % (1083 of 1410) | 74.5 % (549 of 737) | 77.3 % (422 of 546) | 88.2 % (112 of 127) |
Backbone | 90.2 % (666 of 738) | 89.5 % (230 of 257) | 90.6 % (328 of 362) | 90.8 % (108 of 119) |
Sidechain | 66.2 % (519 of 784) | 66.5 % (319 of 480) | 66.2 % (196 of 296) | 50.0 % (4 of 8) |
Aromatic | 10.0 % (4 of 40) | 20.0 % (4 of 20) | 0.0 % (0 of 20) | |
Methyl | 84.4 % (130 of 154) | 85.7 % (66 of 77) | 83.1 % (64 of 77) |
1. entity
GSHMLDHLLE MILLVSEMEE LKANPNRRAV GTVIEAKLDK GRGPVATLLV QAGTLKVGDP IVVGTTYGRV RAMVNDSGRR VKEAGPSMPV EITGLHDVPQ AGDRFMVFED EKKARQIGEA RAQRQSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF2-G3 | [U-100% 13C; U-100% 15N] | 0.15 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | glycerol | natural abundance | 2 % | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_25975_2nbg.nef |
Input source #2: Coordindates | 2nbg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
390-----400-------410-------420-------430-------440-------450-------460-------470-------480-------49 GSHMLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------500-------510---- AGDRFMVFEDEKKARQIGEARAQRQ ||||||||||||||||||||||||| AGDRFMVFEDEKKARQIGEARAQRQ -------110-------120-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 125 | 0 | 0 | 100.0 |
Content subtype: combined_25975_2nbg.nef
Assigned chemical shifts
390-----400-------410-------420-------430-------440-------450-------460-------470-------480-------49 GSHMLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........ILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ 0-------500-------510---- AGDRFMVFEDEKKARQIGEARAQRQ ||||||||||||||||||||||||| AGDRFMVFEDEKKARQIGEARAQRQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 737 | 537 | 72.9 |
13C chemical shifts | 546 | 402 | 73.6 |
15N chemical shifts | 138 | 110 | 79.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 257 | 227 | 88.3 |
13C chemical shifts | 250 | 224 | 89.6 |
15N chemical shifts | 119 | 106 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 480 | 310 | 64.6 |
13C chemical shifts | 296 | 178 | 60.1 |
15N chemical shifts | 19 | 4 | 21.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 58 | 69.9 |
13C chemical shifts | 83 | 57 | 68.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 4 | 20.0 |
13C chemical shifts | 20 | 0 | 0.0 |
Distance restraints
390-----400-------410-------420-------430-------440-------450-------460-------470-------480-------49 GSHMLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ |||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........ILLVSEMEELKANPNR.AVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ 0-------500-------510---- AGDRFMVFEDEKKARQIGEARAQRQ ||||||||||||||||||||||||| AGDRFMVFEDEKKARQIGEARAQRQ
Dihedral angle restraints
390-----400-------410-------420-------430-------440-------450-------460-------470-------480-------49 GSHMLDHLLEMILLVSEMEELKANPNRRAVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPSMPVEITGLHDVPQ ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| .................MEE........AVGTVIEAKLDKGRGPVATLLVQAGTLKVGDPIVVGTTYGRVRAMVNDSGRRVKEAGPS.PVEITGLHDVPQ 390-----400-------410-------420-------430-------440-------450-------460-------470-------480-------49 0-------500-------510---- AGDRFMVFEDEKKARQIGEARAQRQ |||||||||||||||||| AGDRFMVFEDEKKARQIG 0-------500-------