Solution Structure of Ca2+-bound C2 domain from Protein Kinase C alpha in the form of complex with V5-pHM peptide
HTEKRGRIYL KAEVTDEKLH VTVRDAKNLI PMDPNGLSDP YVKLKLIPDP KNESKQKTKT IRSTLNPQWN ESFTFKLKPS DKDRRLSVEI WDWDRTTRND FMGSLSFGVS ELMKMPASGW YKLLNQEEGE YYNVPIPEG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.9 % (1580 of 1701) | 92.7 % (834 of 900) | 92.1 % (605 of 657) | 97.9 % (141 of 144) |
Backbone | 96.6 % (786 of 814) | 98.2 % (270 of 275) | 94.6 % (388 of 410) | 99.2 % (128 of 129) |
Sidechain | 90.4 % (921 of 1019) | 90.2 % (564 of 625) | 90.8 % (344 of 379) | 86.7 % (13 of 15) |
Aromatic | 84.6 % (115 of 136) | 91.2 % (62 of 68) | 76.6 % (49 of 64) | 100.0 % (4 of 4) |
Methyl | 97.7 % (125 of 128) | 96.9 % (62 of 64) | 98.4 % (63 of 64) |
1. C2
HTEKRGRIYL KAEVTDEKLH VTVRDAKNLI PMDPNGLSDP YVKLKLIPDP KNESKQKTKT IRSTLNPQWN ESFTFKLKPS DKDRRLSVEI WDWDRTTRND FMGSLSFGVS ELMKMPASGW YKLLNQEEGE YYNVPIPEGSolvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 600 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 500 MHz RT probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 500 MHz RT probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 500 MHz RT probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Bruker Avance - 800 MHz Cryo probe
State isotropic, Solvent system 92% H2O/8% D2O, Pressure 1 atm, Temperature 296.15 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CALCIUM ION | natural abundance | 2.225 mM | |
2 | C2 | [U-13C; U-15N] | 0.89 mM | |
3 | MES | natural abundance | 6.7 mM | |
4 | potassium chloride | natural abundance | 67 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | pHM peptide | natural abundance | 2 mM | |
7 | H2O | natural abundance | 92 % | |
8 | D2O | natural abundance | 8 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_26016_2nce.nef |
Input source #2: Coordindates | 2nce.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:92:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:33:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:94:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:93:TRP:O | 2:1:CA:CA | unknown | unknown | n/a |
1:33:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:39:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:32:MET:O | 2:2:CA:CA | unknown | unknown | n/a |
1:94:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:33:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:94:ASP:OD2 | 2:2:CA:CA | unknown | unknown | n/a |
1:100:ASP:OD2 | 2:2:CA:CA | unknown | unknown | n/a |
1:92:ASP:OD2 | 2:2:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
B | 2 | CA | CALCIUM ION | None |
Sequence alignments
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---260-------270-------280-------290--- FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG ||||||||||||||||||||||||||||||||||||||| FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG -------110-------120-------130---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 139 | 0 | 0 | 100.0 |
Content subtype: combined_26016_2nce.nef
Assigned chemical shifts
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND ---260-------270-------280-------290--- FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG ||||||||||||||||||||||||||||||||||||||| FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
161 | ARG | CZ | 159.486 |
178 | ARG | CZ | 158.856 |
182 | ASN | CG | 175.434 |
216 | ARG | CZ | 159.198 |
223 | TRP | CE2 | 138.298 |
238 | ARG | CZ | 160.549 |
245 | TRP | CE2 | 138.947 |
247 | TRP | CE2 | 138.823 |
249 | ARG | CZ | 159.406 |
268 | LYS | HZ1 | 4.764 |
268 | LYS | HZ2 | 4.764 |
268 | LYS | HZ3 | 4.764 |
274 | TRP | CE2 | 139.126 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 900 | 830 | 92.2 |
13C chemical shifts | 657 | 594 | 90.4 |
15N chemical shifts | 152 | 148 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 275 | 270 | 98.2 |
13C chemical shifts | 278 | 255 | 91.7 |
15N chemical shifts | 129 | 127 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 625 | 560 | 89.6 |
13C chemical shifts | 379 | 339 | 89.4 |
15N chemical shifts | 23 | 21 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 67 | 98.5 |
13C chemical shifts | 68 | 65 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 62 | 91.2 |
13C chemical shifts | 64 | 49 | 76.6 |
15N chemical shifts | 4 | 4 | 100.0 |
Covalent bonds
Distance restraints
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND ||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .TEKRGRIYLKAEVTDEKLHVTVRDAKNLI.MDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND ---260-------270-------280-------290--- FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG ||||||||||||||||||||||||||||||||||||||| FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND ||||||||||||||||||||||||||||| ||||||| |||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ||| .TEKRGRIYLKAEVTDEKLHVTVRDAKNLI.MDPNGLS.PYVKLKLIPDPKNESKQKTKTIRSTLNPQWNE.FTFKLKPSDKDRRLSVEIWDWDR..RND ---260-------270-------280-------290--- FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG |||||||||||||||||||||||||||||||| |||||| FMGSLSFGVSELMKMPASGWYKLLNQEEGEYY.VPIPEG
Dihedral angle restraints
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRND |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HTEK.GRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTT... ---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- ---260-------270-------280-------290--- FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG |||||||||||||||||||||| |||||||||||||| FMGSLSFGVSELMKMPASGWYK.LNQEEGEYYNVPIP ---260-------270-------280-------290-