Sr33 Coiled-coil domain
SNAGAIAKLI PKLGELLVGE YKLHKGVKKN IEDLLKELKT MNAALIKIGE VPPDQLDSQD KLWADEVREL SYVIEDAVDK FLVRVHGVEP DDNTNGFKGL MKRTTKLLKK VVDKHGIA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.6 % (1176 of 1407) | 78.7 % (579 of 736) | 86.9 % (477 of 549) | 98.4 % (120 of 122) |
Backbone | 87.9 % (615 of 700) | 80.5 % (194 of 241) | 89.6 % (309 of 345) | 98.2 % (112 of 114) |
Sidechain | 81.1 % (662 of 816) | 77.8 % (385 of 495) | 85.9 % (269 of 313) | 100.0 % (8 of 8) |
Aromatic | 86.7 % (52 of 60) | 100.0 % (30 of 30) | 72.4 % (21 of 29) | 100.0 % (1 of 1) |
Methyl | 85.0 % (136 of 160) | 77.5 % (62 of 80) | 92.5 % (74 of 80) |
1. entity
SNAGAIAKLI PKLGELLVGE YKLHKGVKKN IEDLLKELKT MNAALIKIGE VPPDQLDSQD KLWADEVREL SYVIEDAVDK FLVRVHGVEP DDNTNGFKGL MKRTTKLLKK VVDKHGIASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 450 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_26021_2ncg.nef |
Input source #2: Coordindates | 2ncg.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----110-------120 MKRTTKLLKKVVDKHGIA |||||||||||||||||| MKRTTKLLKKVVDKHGIA -------110--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 118 | 0 | 0 | 100.0 |
Content subtype: combined_26021_2ncg.nef
Assigned chemical shifts
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL -----110-------120 MKRTTKLLKKVVDKHGIA |||||||||||||||||| MKRTTKLLKKVVDKHGIA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 736 | 701 | 95.2 |
13C chemical shifts | 549 | 506 | 92.2 |
15N chemical shifts | 125 | 120 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 241 | 238 | 98.8 |
13C chemical shifts | 236 | 226 | 95.8 |
15N chemical shifts | 114 | 112 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 495 | 463 | 93.5 |
13C chemical shifts | 313 | 280 | 89.5 |
15N chemical shifts | 11 | 8 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 82 | 100.0 |
13C chemical shifts | 82 | 81 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 30 | 30 | 100.0 |
13C chemical shifts | 29 | 21 | 72.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| |||||||||| | .NAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLD.QDKLWADEVRELSYVIEDAVDKFLVRVH.VEPDDNTNGF..L -----110-------120 MKRTTKLLKKVVDKHGIA |||||||||||||||||| MKRTTKLLKKVVDKHGIA
Dihedral angle restraints
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAGAIAKLIPKLGELLVGEYKLHKGVKKNIEDLLKELKTMNAALIKIGEVPPDQLDSQDKLWADEVRELSYVIEDAVDKFLVRVHGVEPDDNTNGFKGL -----110-------120 MKRTTKLLKKVVDKHGIA |||||||||||||||||| MKRTTKLLKKVVDKHGIA