Solution structure of translation initiation factor IF1 from wolbachia endosymbiont strain TRS of Brugia malayi
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.5 % (953 of 1042) | 90.7 % (498 of 549) | 91.9 % (372 of 405) | 94.3 % (83 of 88) |
Backbone | 97.5 % (507 of 520) | 96.1 % (171 of 178) | 98.8 % (253 of 256) | 96.5 % (83 of 86) |
Sidechain | 87.3 % (527 of 604) | 88.1 % (327 of 371) | 86.6 % (200 of 231) | 0.0 % (0 of 2) |
Aromatic | 33.3 % (12 of 36) | 66.7 % (12 of 18) | 0.0 % (0 of 18) | |
Methyl | 95.6 % (109 of 114) | 96.5 % (55 of 57) | 94.7 % (54 of 57) |
1. IF1
MVKDEKSKTL FEVEGAVTAL LPAAEFRVKL DNEHEIICHV SGKVRRSKIR IIIGDRVLVE MSIYDRNAKK GRIIRRLKGT SDRTISKSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF1 | [U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | PMSF | natural abundance | 2 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF1 | [U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF1 | [U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IF1 | [U-100% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | IF1 | [U-100% 13C; U-100% 15N] | 0.8 ~ 1.0 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | sodium azide | natural abundance | 0.1 % | |
10 | PMSF | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | IF1 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 50 mM | |
14 | sodium azide | natural abundance | 0.1 % | |
15 | PMSF | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_26022_2nch.nef |
Input source #2: Coordindates | 2nch.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80------- MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_26022_2nch.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------- MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
39 | HIS | HD1 | 10.28 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 549 | 507 | 92.3 |
13C chemical shifts | 405 | 376 | 92.8 |
15N chemical shifts | 98 | 83 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 178 | 174 | 97.8 |
13C chemical shifts | 174 | 174 | 100.0 |
15N chemical shifts | 86 | 83 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 371 | 333 | 89.8 |
13C chemical shifts | 231 | 202 | 87.4 |
15N chemical shifts | 12 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 55 | 93.2 |
13C chemical shifts | 59 | 54 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 12 | 66.7 |
13C chemical shifts | 18 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80------- MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80------- MVKDEKSKTLFEVEGAVTALLPAAEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKGTSDRTISK ||||| ||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| .VKDEK.KTLFEVEGAVTALLP.AEFRVKLDNEHEIICHVSGKVRRSKIRIIIGDRVLVEMSIYDRNAKKGRIIRRLKG.SDR --------10--------20--------30--------40--------50--------60--------70--------80---