Solution Structure of the PriC DNA replication restart protein
MRTPLLLQSL KTRVAALHTL IGPLASQRHF SPRFDRQLFA CRGARLGDYL TEAEESLTHL EAAVNQGDAT RVAWLAERLA AQIEALQREA ATATLRRHEN AHLPGGRLHA RLAEYQEYER RLLAMKNERE QRYAERHDPQ LAREITALDE RLTRCRTAIA RTERALERIT R
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.2 % (1454 of 1987) | 68.0 % (708 of 1041) | 78.9 % (605 of 767) | 78.8 % (141 of 179) |
Backbone | 85.6 % (870 of 1016) | 83.7 % (287 of 343) | 87.4 % (443 of 507) | 84.3 % (140 of 166) |
Sidechain | 63.5 % (721 of 1136) | 59.2 % (413 of 698) | 72.2 % (307 of 425) | 7.7 % (1 of 13) |
Aromatic | 22.5 % (23 of 102) | 35.3 % (18 of 51) | 8.0 % (4 of 50) | 100.0 % (1 of 1) |
Methyl | 83.5 % (177 of 212) | 81.1 % (86 of 106) | 85.8 % (91 of 106) |
1. PriC
MRTPLLLQSL KTRVAALHTL IGPLASQRHF SPRFDRQLFA CRGARLGDYL TEAEESLTHL EAAVNQGDAT RVAWLAERLA AQIEALQREA ATATLRRHEN AHLPGGRLHA RLAEYQEYER RLLAMKNERE QRYAERHDPQ LAREITALDE RLTRCRTAIA RTERALERIT RSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 3.1:1 DMPC: DHPC (1,2-Dimyristoyl-sn-Glycero-3-Phosphocholine:1,2-Dihexanoyl-sn-Glycero-3-Phosphocholine bicelles) at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | PriC | [U-13C; U-15N] | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.658 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.658 ppm | internal | direct | 1.0 |
15N | water | protons | 4.658 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.658 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.658 ppm | internal | direct | 1.0 |
15N | water | protons | 4.658 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.658 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.658 ppm | internal | direct | 1.0 |
15N | water | protons | 4.658 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.658 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.658 ppm | internal | direct | 1.0 |
15N | water | protons | 4.658 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Varian INOVA - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Varian INOVA - 900 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 3.1:1 DMPC: DHPC (1,2-Dimyristoyl-sn-Glycero-3-Phosphocholine:1,2-Dihexanoyl-sn-Glycero-3-Phosphocholine bicelles) at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | PriC | [U-13C; U-15N] | 0.5 mM |
Bruker Avance - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 20 mM MES, pH 6.5, 5 mM DTT, 1 mM EDTA, 1x EDTA-free protease inhibitor cocktail (Roche), 5% D2O, isotropic NMR data at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PriC | [U-13C; U-15N] | 0.5 mM | |
2 | MES | natural abundance | 20 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | EDTA | natural abundance | 1 mM |
Bruker Avance - 750 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5 (±0.1), Details 3.1:1 DMPC: DHPC (1,2-Dimyristoyl-sn-Glycero-3-Phosphocholine:1,2-Dihexanoyl-sn-Glycero-3-Phosphocholine bicelles) at 37 C.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | PriC | [U-13C; U-15N] | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts | combined_26026_2ncj.nef |
Input source #2: Coordindates | 2ncj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRTPLLLQSLKTRVAALHTLIGPLASQRHFSPRFDRQLFACRGARLGDYLTEAEESLTHLEAAVNQGDATRVAWLAERLAAQIEALQREAATATLRRHEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRTPLLLQSLKTRVAALHTLIGPLASQRHFSPRFDRQLFACRGARLGDYLTEAEESLTHLEAAVNQGDATRVAWLAERLAAQIEALQREAATATLRRHEN -------110-------120-------130-------140-------150-------160-------170- AHLPGGRLHARLAEYQEYERRLLAMKNEREQRYAERHDPQLAREITALDERLTRCRTAIARTERALERITR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AHLPGGRLHARLAEYQEYERRLLAMKNEREQRYAERHDPQLAREITALDERLTRCRTAIARTERALERITR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 171 | 0 | 0 | 100.0 |
Content subtype: combined_26026_2ncj.nef
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chem_shift_list_1 | Warning | 1336 | 88.3 (chain: A, length: 171) |
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRTPLLLQSLKTRVAALHTLIGPLASQRHFSPRFDRQLFACRGARLGDYLTEAEESLTHLEAAVNQGDATRVAWLAERLAAQIEALQREAATATLRRHEN |||||||||||||||||||||||| |||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| ...PLLLQSLKTRVAALHTLIGPLASQ..FSPRFDRQLFACRGARLGDYLTEAEESLTH.EAAVNQGDATRVAWLAERLAAQIEALQREAATATLRRHEN -------110-------120-------130-------140-------150-------160-------170- AHLPGGRLHARLAEYQEYERRLLAMKNEREQRYAERHDPQLAREITALDERLTRCRTAIARTERALERITR |||||| |||||| | ||||||| ||| |||||||||||||| |||||||||||| |||||||| AHLPGG.LHARLA....Y..RLLAMKN..EQR.AERHDPQLAREITA.DERLTRCRTAIA...RALERITR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1041 | 634 | 60.9 |
13C chemical shifts | 767 | 568 | 74.1 |
15N chemical shifts | 206 | 134 | 65.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 343 | 271 | 79.0 |
13C chemical shifts | 342 | 283 | 82.7 |
15N chemical shifts | 166 | 133 | 80.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 698 | 363 | 52.0 |
13C chemical shifts | 425 | 285 | 67.1 |
15N chemical shifts | 40 | 1 | 2.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 108 | 80 | 74.1 |
13C chemical shifts | 108 | 86 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 17 | 33.3 |
13C chemical shifts | 50 | 2 | 4.0 |
15N chemical shifts | 1 | 1 | 100.0 |