NMR solution structure of MAL/TIRAP TIR domain
SSRWSKDYDV CVCHSEEDLV AAQDLVSYLE GSTASLRAFL QLRDATPGGA IVSELCQALS SSHCRVLLIT PGFLQDPWCK YQMLQALTEA PGAEGCTIPL LSGLSRAAYP PELRFMYYVD GRGPDGGFRQ VKEAVMRYLQ TLS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 68.7 % (1107 of 1611) | 67.9 % (564 of 831) | 68.7 % (436 of 635) | 73.8 % (107 of 145) |
Backbone | 78.9 % (664 of 842) | 77.2 % (223 of 289) | 80.9 % (338 of 418) | 76.3 % (103 of 135) |
Sidechain | 61.5 % (554 of 901) | 62.9 % (341 of 542) | 59.9 % (209 of 349) | 40.0 % (4 of 10) |
Aromatic | 31.3 % (40 of 128) | 39.1 % (25 of 64) | 22.6 % (14 of 62) | 50.0 % (1 of 2) |
Methyl | 78.4 % (127 of 162) | 85.2 % (69 of 81) | 71.6 % (58 of 81) |
1. entity
SSRWSKDYDV CVCHSEEDLV AAQDLVSYLE GSTASLRAFL QLRDATPGGA IVSELCQALS SSHCRVLLIT PGFLQDPWCK YQMLQALTEA PGAEGCTIPL LSGLSRAAYP PELRFMYYVD GRGPDGGFRQ VKEAVMRYLQ TLSSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Bruker Avance - 900 MHz equipped with cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 291 K, pH 8.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 300 uM | |
2 | TRIS | natural abundance | 20 mM | |
3 | D2O | natural abundance | 5 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_26061_2ndh.nef |
Input source #2: Coordindates | 2ndh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-80-------90-------100-------110-------120-------130-------140-------150-------160-------170-------1 SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 80-------190-------200-------210-------220- LSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS ||||||||||||||||||||||||||||||||||||||||||| LSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS -------110-------120-------130-------140---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 143 | 0 | 0 | 100.0 |
Content subtype: combined_26061_2ndh.nef
Assigned chemical shifts
-80-------90-------100-------110-------120-------130-------140-------150-------160-------170-------1 SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPL |||||||||||||||||||||||||||| |||||||||||||| ||| || |||||||||||||||||||||||||||||| ||||||||| ...WSKDYDVCVCHSEEDLVAAQDLVSYLEG.TASLRAFLQLRDAT...AIV.....AL.SSHCRVLLITPGFLQDPWCKYQMLQALTEA.GAEGCTIPL 80-------190-------200-------210-------220- LSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS |||| ||| ||| |||| ||||||||||||||||||| LSGL..AAY.PEL.....VDGR..DGGFRQVKEAVMRYLQTLS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 831 | 528 | 63.5 |
13C chemical shifts | 635 | 419 | 66.0 |
15N chemical shifts | 154 | 104 | 67.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 215 | 74.4 |
13C chemical shifts | 286 | 223 | 78.0 |
15N chemical shifts | 135 | 100 | 74.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 542 | 313 | 57.7 |
13C chemical shifts | 349 | 196 | 56.2 |
15N chemical shifts | 19 | 4 | 21.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 67 | 79.8 |
13C chemical shifts | 84 | 53 | 63.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 23 | 35.9 |
13C chemical shifts | 62 | 14 | 22.6 |
15N chemical shifts | 2 | 1 | 50.0 |
Distance restraints
-80-------90-------100-------110-------120-------130-------140-------150-------160-------170-------1 SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPL |||||||||||||||||||||||||||| |||||||| ||||| || |||||||||||||||||||||||||||||| ||||||||| ...WSKDYDVCVCHSEEDLVAAQDLVSYLEG.TASLRAFL.LRDAT....IV........SSHCRVLLITPGFLQDPWCKYQMLQALTEA.GAEGCTIPL 80-------190-------200-------210-------220- LSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS || | ||| ||| |||| ||||||||||||||||||| LS.L..AAY.PEL.....VDGR..DGGFRQVKEAVMRYLQTLS
Dihedral angle restraints
-80-------90-------100-------110-------120-------130-------140-------150-------160-------170-------1 SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPL |||||||||||||||||||||||||||||||||||||||||||| ||| ||||||||||||||||||||||||||||||||||| |||||||| ...WSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRAFLQLRDATP..AIV....QALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAP.AEGCTIPL 80-------190-------200-------210-------220- LSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS |||||||||||||| ||||||||||||||||||||||||| LSGLSRAAYPPELR....VDGRGPDGGFRQVKEAVMRYLQTLS