NMR study of non-structural proteins - 1H, 13C, 15N resonance assignment of macro domain of Venezuelan equine encephalitis virus (VEEV) in complex with ADP-ribose
APSYHVVRGD IATATEGVII NAANSKGQPG GGVCGALYKK FPESFDLQPI EVGKARLVKG AAKHIIHAVG PNFNKVSEVE GDKQLAEAYE SIAKIVNDNN YKSVAIPLLS TGIFSGNKDR LTQSLNHLLT ALDTTDADVA IYCRDKKWEM TLKEAVARRE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.7 % (1656 of 1806) | 90.9 % (848 of 933) | 92.8 % (654 of 705) | 91.7 % (154 of 168) |
Backbone | 96.8 % (918 of 948) | 96.3 % (315 of 327) | 97.0 % (453 of 467) | 97.4 % (150 of 154) |
Sidechain | 87.9 % (883 of 1005) | 88.0 % (533 of 606) | 89.9 % (346 of 385) | 28.6 % (4 of 14) |
Aromatic | 38.9 % (42 of 108) | 40.7 % (22 of 54) | 35.8 % (19 of 53) | 100.0 % (1 of 1) |
Methyl | 100.0 % (198 of 198) | 100.0 % (99 of 99) | 100.0 % (99 of 99) |
1. VEEV macro domain
APSYHVVRGD IATATEGVII NAANSKGQPG GGVCGALYKK FPESFDLQPI EVGKARLVKG AAKHIIHAVG PNFNKVSEVE GDKQLAEAYE SIAKIVNDNN YKSVAIPLLS TGIFSGNKDR LTQSLNHLLT ALDTTDADVA IYCRDKKWEM TLKEAVARRESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.18 mM | |
2 | Adenosine diphosphate ribose | natural abundance | 0.2 mM | |
3 | Buffer HEPES | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 20 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.18 mM | |
2 | Adenosine diphosphate ribose | natural abundance | 0.2 mM | |
3 | Buffer HEPES | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.18 mM | |
2 | Adenosine diphosphate ribose | natural abundance | 0.2 mM | |
3 | Buffer HEPES | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VEEV macro domain | [U-99% 15N] | 0.18 mM | |
2 | Adenosine diphosphate ribose | natural abundance | 0.2 mM | |
3 | Buffer HEPES | natural abundance | 10 mM | |
4 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Bruker Avance HD-III HD - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | VEEV macro domain | [U-98% 13C; U-98% 15N] | 0.21 mM | |
6 | Adenosine diphosphate ribose | natural abundance | 0.26 mM | |
7 | Buffer HEPES | natural abundance | 10 mM | |
8 | NaCl | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_26753_5mqx.nef |
Input source #2: Coordindates | 5mqx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | APR | ADENOSINE-5-DIPHOSPHORIBOSE | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 APSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| APSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN -------110-------120-------130-------140-------150-------160------ YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 166 | 0 | 0 | 100.0 |
Content subtype: combined_26753_5mqx.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 APSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN |||||||||||||||||||||||||||| |||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| APSYHVVRGDIATATEGVIINAANSKGQ.GGGV.GALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160------ YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE -------110-------120-------130-------140-------150-------160
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 969 | 857 | 88.4 |
13C chemical shifts | 735 | 651 | 88.6 |
15N chemical shifts | 180 | 153 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 339 | 319 | 94.1 |
13C chemical shifts | 332 | 305 | 91.9 |
15N chemical shifts | 160 | 149 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 630 | 538 | 85.4 |
13C chemical shifts | 403 | 346 | 85.9 |
15N chemical shifts | 20 | 4 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 100 | 99 | 99.0 |
13C chemical shifts | 100 | 99 | 99.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 22 | 33.3 |
13C chemical shifts | 65 | 19 | 29.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 APSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN |||||||||||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| APSYHVVRGDIATATEGVIINAANSKGQ..GGV.GALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160------ YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARREHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| YKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE -------110-------120-------130-------140-------150-------160