'1H, 13C, and 15N Chemical Shift Assignments for the periplasmic domain of GacS histidine-kinase'
MGHHHHHHSS GVDLGTENLY FQSMRAQLIE RGQLIAEQLA PLAATALARK DTAVLNRIAN EALDQPDVRA VTFLDARQER LAHAGPSMLT VAPAGDASHL SMSTELDTTH FLLPVLGRHH SLSGATEPDD ERVLGWVELE LSHHGTLLRG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1480 of 1650) | 90.9 % (767 of 844) | 87.6 % (571 of 652) | 92.2 % (142 of 154) |
Backbone | 92.6 % (822 of 888) | 93.8 % (286 of 305) | 92.0 % (404 of 439) | 91.7 % (132 of 144) |
Sidechain | 87.0 % (784 of 901) | 89.2 % (481 of 539) | 83.2 % (293 of 352) | 100.0 % (10 of 10) |
Aromatic | 45.1 % (46 of 102) | 49.0 % (25 of 51) | 40.0 % (20 of 50) | 100.0 % (1 of 1) |
Methyl | 96.4 % (185 of 192) | 99.0 % (95 of 96) | 93.8 % (90 of 96) |
1. GacSperi
MGHHHHHHSS GVDLGTENLY FQSMRAQLIE RGQLIAEQLA PLAATALARK DTAVLNRIAN EALDQPDVRA VTFLDARQER LAHAGPSMLT VAPAGDASHL SMSTELDTTH FLLPVLGRHH SLSGATEPDD ERVLGWVELE LSHHGTLLRGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GacSperi | natural abundance | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | GacSperi | [U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GacSperi | natural abundance | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GacSperi | natural abundance | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | GacSperi | [U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | GacSperi | [U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | GacSperi | [U-100% 15N] | 0.8 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | GacSperi | [U-100% 13C; U-100% 15N] | 0.8 mM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_26840_5o7j.nef |
Input source #2: Coordindates | 5o7j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----20--------30--------40--------50--------60--------70--------80--------90-------100-------110---- MGHHHHHHSSGVDLGTENLYFQSMRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSSGVDLGTENLYFQSMRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---120-------130-------140-------150-------160---- SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG |||||||||||||||||||||||||||||||||||||||||||||||||| SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG -------110-------120-------130-------140-------150
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 150 | 0 | 0 | 100.0 |
Content subtype: combined_26840_5o7j.nef
Assigned chemical shifts
----20--------30--------40--------50--------60--------70--------80--------90-------100-------110---- MGHHHHHHSSGVDLGTENLYFQSMRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL | | ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .G.....H.SGVDLGTENLYFQ.MRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL ---120-------130-------140-------150-------160---- SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG |||||||||||||||||||||||||||||||||||||||||||||||||| SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
41 | GLN | CD | 180.214 |
44 | GLU | CD | 183.707 |
47 | GLN | CD | 179.661 |
51 | GLU | CD | 184.177 |
75 | GLU | CD | 183.838 |
79 | GLN | CD | 180.051 |
93 | GLU | CD | 183.837 |
94 | ARG | HH21 | 6.927 |
94 | ARG | HH22 | 6.927 |
94 | ARG | NH2 | 71.51 |
101 | SER | HG | 5.279 |
119 | GLU | CD | 183.508 |
124 | HIS | CG | 133.042 |
141 | GLU | CD | 183.727 |
145 | GLU | CD | 183.672 |
152 | GLU | CD | 183.904 |
163 | ARG | HH11 | 7.072 |
163 | ARG | HH12 | 7.072 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 844 | 767 | 90.9 |
13C chemical shifts | 652 | 556 | 85.3 |
15N chemical shifts | 164 | 147 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 305 | 288 | 94.4 |
13C chemical shifts | 300 | 274 | 91.3 |
15N chemical shifts | 144 | 131 | 91.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 479 | 88.9 |
13C chemical shifts | 352 | 282 | 80.1 |
15N chemical shifts | 20 | 16 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 100 | 98 | 98.0 |
13C chemical shifts | 100 | 85 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 23 | 45.1 |
13C chemical shifts | 50 | 20 | 40.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
----20--------30--------40--------50--------60--------70--------80--------90-------100-------110---- MGHHHHHHSSGVDLGTENLYFQSMRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......................MRAQLIERGQLIAEQLAPLAATALARKDTAVLNRIANEALDQPDVRAVTFLDARQERLAHAGPSMLTVAPAGDASHL ---120-------130-------140-------150-------160---- SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG |||||||||||||||||||||||||||||||||||||||||||||||||| SMSTELDTTHFLLPVLGRHHSLSGATEPDDERVLGWVELELSHHGTLLRG