Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Sequence alignments

• Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20-
GIVEQCCASVCSLYQLENYCN
|||||||||||||||||||||
GIVEQCCASVCSLYQLENYCN

• Entity_assembly_ID (NMR): B vs Auth_asym_ID (model): B

--------10--------20--------30
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
||||||||||||||||||||||||||||||
FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Chain assignments

Content subtype: combined_26889_5miz.nef

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: Error

Covalent bonds

1. Saveframe: assembly
   • Status: OK

Distance restraints

1. Saveframe: CNS/XPLOR_distance_constraints_2
   • Status: OK
   • Experiment type: noe
   • Sequence coverage of experimental data
     • Entity_assembly_ID: A, Chain length: 21, Sequence coverage: 100.0%

     --------10--------20-
     GIVEQCCASVCSLYQLENYCN
     |||||||||||||||||||||
     GIVEQCCASVCSLYQLENYCN
     

     • Entity_assembly_ID: B, Chain length: 30, Sequence coverage: 100.0%

     --------10--------20--------30
     FVNQHLCGSHLVEALYLVCGERGFFYTPKA
     ||||||||||||||||||||||||||||||
     FVNQHLCGSHLVEALYLVCGERGFFYTPKA
     

   • Total number of restraints: 431
     • Intra-residue restraints, i = j : 226
     • Sequential restraints, | i - j | = 1 : 100
       • Backbone-backbone: 49
       • Backbone-side chain: 48
       • Side chain-side chain: 3
     • Medium range restraints, 1 < | i - j | < 5 : 73
       • Backbone-backbone: 21
       • Backbone-side chain: 29
       • Side chain-side chain: 23
     • Long range restraints, | i - j | >= 5 : 7
     • Inter-chain restraints: 18
     • Symmetric restraints: 7
   • Weight of restraints: 1.0 (431)
     • Intra-residue restraints, i = j : 1.0 (226)
     • Sequential restraints, | i - j | = 1 : 1.0 (100)
       • Backbone-backbone: 1.0 (49)
       • Backbone-side chain: 1.0 (48)
       • Side chain-side chain: 1.0 (3)
     • Medium range restraints, 1 < | i - j | < 5 : 1.0 (73)
       • Backbone-backbone: 1.0 (21)
       • Backbone-side chain: 1.0 (29)
       • Side chain-side chain: 1.0 (23)
     • Long range restraints, | i - j | >= 5 : 1.0 (7)
     • Inter-chain restraints: 1.0 (18)
     • Symmetric restraints: 1.0 (7)
   • Potential type of restraints: square-well-parabolic (431)
     • Intra-residue restraints, i = j : square-well-parabolic (226)
     • Sequential restraints, | i - j | = 1 : square-well-parabolic (100)
       • Backbone-backbone: square-well-parabolic (49)
       • Backbone-side chain: square-well-parabolic (48)
       • Side chain-side chain: square-well-parabolic (3)
     • Medium range restraints, 1 < | i - j | < 5 : square-well-parabolic (73)
       • Backbone-backbone: square-well-parabolic (21)
       • Backbone-side chain: square-well-parabolic (29)
       • Side chain-side chain: square-well-parabolic (23)
     • Long range restraints, | i - j | >= 5 : square-well-parabolic (7)
     • Inter-chain restraints: square-well-parabolic (18)
     • Symmetric restraints: square-well-parabolic (7)
   • Range of distance target values: 2.0, 5.0 (Å)
   • Histogram of distance target values
   • Histogram of discrepancy in distance target values
   • Distance restraints per residue
     • Chain_ID: A
     • Chain_ID: B
   • Distance restraints on contact map
     • Chain_ID_1: A - Chain_ID_2: A
     • Chain_ID_1: B - Chain_ID_2: B
     • Chain_ID_1: A - Chain_ID_2: B