1H, 15N and 13C resonance assignments and secondary structure of PulG, the major pseudopilin from Klebsiella oxytoca Type 2 Secretion System
MGNKEKADRQ KVVSDLVALE GALDMYKLDN SRYPTTEQGL QALVSAPSAE PHARNYPEGG YIRRLPQDPW GSDYQLLSPG QHGQVDIFSL GPDGVPESND DIGNWTIGFH HHHHHK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.2 % (1098 of 1319) | 81.0 % (558 of 689) | 85.3 % (434 of 509) | 87.6 % (106 of 121) |
Backbone | 89.7 % (608 of 678) | 88.1 % (207 of 235) | 90.2 % (303 of 336) | 91.6 % (98 of 107) |
Sidechain | 78.4 % (584 of 745) | 77.3 % (351 of 454) | 81.2 % (225 of 277) | 57.1 % (8 of 14) |
Aromatic | 62.1 % (72 of 116) | 67.2 % (39 of 58) | 55.4 % (31 of 56) | 100.0 % (2 of 2) |
Methyl | 84.0 % (84 of 100) | 84.0 % (42 of 50) | 84.0 % (42 of 50) |
1. PulG
MGNKEKADRQ KVVSDLVALE GALDMYKLDN SRYPTTEQGL QALVSAPSAE PHARNYPEGG YIRRLPQDPW GSDYQLLSPG QHGQVDIFSL GPDGVPESND DIGNWTIGFH HHHHHKSolvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
7 | HEPES | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 50 mM | |
9 | D2O | [U-100% 2H] | 10 % | |
10 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Varian UnityInova - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.000 atm, Temperature 298.000 K, pH 7.000, Details in 50 mM HEPES pH 7 50 mM 1 mM CaCl2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PulG | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | HEPES | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | CaCl2 | natural abundance | 1.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_26919_5o2y.nef |
Input source #2: Coordindates | 5o2y.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:90:LEU:O | 2:1:CA:CA | unknown | unknown | n/a |
1:93:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
1:95:VAL:O | 2:1:CA:CA | unknown | unknown | n/a |
1:98:SER:OG | 2:1:CA:CA | unknown | unknown | n/a |
1:101:ASP:OD2 | 2:1:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
Sequence alignments
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---130-------140 DIGNWTIGFHHHHHHK |||||||||||||||| DIGNWTIGFHHHHHHK -------110------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_26919_5o2y.nef
Assigned chemical shifts
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...KEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND ----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- ---130-------140 DIGNWTIGFHHHHHHK ||||||||| DIGNWTIGF ---130---
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
76 | HIS | HD1 | 6.858 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 509 | 421 | 82.7 |
1H chemical shifts | 689 | 541 | 78.5 |
15N chemical shifts | 126 | 103 | 81.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 232 | 207 | 89.2 |
1H chemical shifts | 235 | 204 | 86.8 |
15N chemical shifts | 107 | 95 | 88.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 277 | 214 | 77.3 |
1H chemical shifts | 454 | 337 | 74.2 |
15N chemical shifts | 19 | 8 | 42.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 52 | 42 | 80.8 |
1H chemical shifts | 52 | 44 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 56 | 31 | 55.4 |
1H chemical shifts | 58 | 39 | 67.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- MGNKEKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....EKADRQKVVSDLVALEGALDMYKLDNSRYPTTEQGLQALVSAPSAEPHARNYPEGGYIRRLPQDPWGSDYQLLSPGQHGQVDIFSLGPDGVPESND ----30--------40--------50--------60--------70--------80--------90-------100-------110-------120---- ---130-------140 DIGNWTIGFHHHHHHK ||||||||| DIGNWTIGF ---130---