1H, 13C and 15N chemical shift assignments of A. thaliana RCD1(468-569)
GSPEFMGVTL EGPKDLPPQL ESNQGARGSG SANSVGSSTT RPKSPWMPFP TLFAAISHKV AENDMLLINA DYQQLRDKKM TRAEFVRKLR VIVGDDLLRS TITTLQNQPK SKEIPGSIRD HEEGAGGL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1296 of 1457) | 88.3 % (676 of 766) | 89.7 % (503 of 561) | 90.0 % (117 of 130) |
Backbone | 91.8 % (687 of 748) | 91.1 % (235 of 258) | 92.7 % (345 of 372) | 90.7 % (107 of 118) |
Sidechain | 87.0 % (718 of 825) | 86.8 % (441 of 508) | 87.5 % (267 of 305) | 83.3 % (10 of 12) |
Aromatic | 60.3 % (41 of 68) | 73.5 % (25 of 34) | 45.5 % (15 of 33) | 100.0 % (1 of 1) |
Methyl | 100.0 % (128 of 128) | 100.0 % (64 of 64) | 100.0 % (64 of 64) |
1. RCD1
GSPEFMGVTL EGPKDLPPQL ESNQGARGSG SANSVGSSTT RPKSPWMPFP TLFAAISHKV AENDMLLINA DYQQLRDKKM TRAEFVRKLR VIVGDDLLRS TITTLQNQPK SKEIPGSIRD HEEGAGGLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514502 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514502 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514502 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TMS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514502 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RCD1 | [U-13C; U-15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27034_5n9q.nef |
Input source #2: Coordindates | 5n9q.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------470-------480-------490-------500-------510-------520-------530-------540-------550-------560- GSPEFMGVTLEGPKDLPPQLESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSPEFMGVTLEGPKDLPPQLESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------570-------580--------- TITTLQNQPKSKEIPGSIRDHEEGAGGL |||||||||||||||||||||||||||| TITTLQNQPKSKEIPGSIRDHEEGAGGL -------110-------120--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_27034_5n9q.nef
Assigned chemical shifts
------470-------480-------490-------500-------510-------520-------530-------540-------550-------560- GSPEFMGVTLEGPKDLPPQLESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS ||||||||||||||||||||||||||||||||||| |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| .SPEFMGVTLEGPKDLPPQLESNQGARGSGSANSVG.STTRPKSPWM...TLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS ------570-------580--------- TITTLQNQPKSKEIPGSIRDHEEGAGGL |||||||||||||||||||||||||||| TITTLQNQPKSKEIPGSIRDHEEGAGGL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
464 | PRO | N | 137.128 |
474 | PRO | N | 134.466 |
478 | PRO | N | 137.542 |
479 | PRO | N | 135.116 |
506 | PRO | N | 138.035 |
570 | PRO | N | 137.318 |
572 | SER | HG | 5.576 |
576 | PRO | N | 140.46 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 561 | 500 | 89.1 |
1H chemical shifts | 766 | 674 | 88.0 |
15N chemical shifts | 138 | 116 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 256 | 234 | 91.4 |
1H chemical shifts | 258 | 235 | 91.1 |
15N chemical shifts | 118 | 107 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 305 | 266 | 87.2 |
1H chemical shifts | 508 | 439 | 86.4 |
15N chemical shifts | 20 | 9 | 45.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 68 | 68 | 100.0 |
1H chemical shifts | 68 | 68 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 33 | 15 | 45.5 |
1H chemical shifts | 34 | 25 | 73.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------470-------480-------490-------500-------510-------520-------530-------540-------550-------560- GSPEFMGVTLEGPKDLPPQLESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS ||| |||||||||||||||| ||||| || | ||||| ||| |||||||||||||||||||||||||||||||||||||||||||||||||| ..PEF.GVTLEGPKDLPPQLES.QGARG...AN.V...TTRPK.PWM...TLFAAISHKVAENDMLLINADYQQLRDKKMTRAEFVRKLRVIVGDDLLRS ------570-------580--------- TITTLQNQPKSKEIPGSIRDHEEGAGGL |||||||||||||||||||||||||||| TITTLQNQPKSKEIPGSIRDHEEGAGGL
Dihedral angle restraints