1H, 13C, and 15N backbone and side chain resonance assignments for a structured domain in atg32
SNATNSFVMP KLSLTQKNPV FRLLILGRTG SSFYQSIPKE YQSLFELPKY HDSATFPQYT GIVIIFQELR EMVSLLNRIV QYSQGKPVIP ICQPGQVIQV KNVLKSFLRN KLVKLLFPPV VVTNKRDLKK MFQRLQDLSL EYGED
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.5 % (1615 of 1824) | 90.0 % (864 of 960) | 86.1 % (611 of 710) | 90.9 % (140 of 154) |
Backbone | 95.5 % (812 of 850) | 95.1 % (272 of 286) | 95.8 % (411 of 429) | 95.6 % (129 of 135) |
Sidechain | 84.1 % (936 of 1113) | 87.8 % (592 of 674) | 79.3 % (333 of 420) | 57.9 % (11 of 19) |
Aromatic | 40.1 % (57 of 142) | 76.1 % (54 of 71) | 4.2 % (3 of 71) | |
Methyl | 98.3 % (177 of 180) | 100.0 % (90 of 90) | 96.7 % (87 of 90) |
1. atg32
SNATNSFVMP KLSLTQKNPV FRLLILGRTG SSFYQSIPKE YQSLFELPKY HDSATFPQYT GIVIIFQELR EMVSLLNRIV QYSQGKPVIP ICQPGQVIQV KNVLKSFLRN KLVKLLFPPV VVTNKRDLKK MFQRLQDLSL EYGEDSolvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | atg32 | natural abundance | 370 uM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | TCEP | natural abundance | 0.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Ascend - 850 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | atg32 | natural abundance | 370 uM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | atg32 | natural abundance | 370 uM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | atg32 | natural abundance | 370 uM | |
6 | sodium phosphate | natural abundance | 20 mM | |
7 | sodium chloride | natural abundance | 100 mM | |
8 | TCEP | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 99% H2O 1% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | atg32 | [U-99% 13C; U-99% 15N] | 750 uM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | TCEP | natural abundance | 0.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27081_5wlp.nef |
Input source #2: Coordindates | 5wlp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQV -------110-------120-------130-------140----- KNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED ||||||||||||||||||||||||||||||||||||||||||||| KNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 145 | 0 | 0 | 100.0 |
Content subtype: combined_27081_5wlp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQV ||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| |||||| .NATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKY..SATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQ.GQVIQV -------110-------120-------130-------140----- KNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED ||||||||||||||||| ||||||||||||||||||||||||||| KNVLKSFLRNKLVKLLF.PVVVTNKRDLKKMFQRLQDLSLEYGED
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 960 | 858 | 89.4 |
13C chemical shifts | 710 | 603 | 84.9 |
15N chemical shifts | 161 | 140 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 286 | 273 | 95.5 |
13C chemical shifts | 290 | 278 | 95.9 |
15N chemical shifts | 135 | 129 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 674 | 585 | 86.8 |
13C chemical shifts | 420 | 325 | 77.4 |
15N chemical shifts | 26 | 11 | 42.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 91 | 97.8 |
13C chemical shifts | 93 | 88 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 53 | 74.6 |
13C chemical shifts | 71 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQV |||||||||||||||| |||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| |||||| .NATNSFVMPKLSLTQK.PVFRLLILGRTGSSFYQSIPKEYQSLFELPKY..SATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQ.GQVIQV -------110-------120-------130-------140----- KNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED ||||||||||||||||| ||||||||||||||||||||||||||| KNVLKSFLRNKLVKLLF.PVVVTNKRDLKKMFQRLQDLSLEYGED
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SNATNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQV |||||||| |||||||| |||||| ||||||||| ||||||| ||||||| ||| ||||||||||||||||||||||||| || | SNATNSFV..KLSLTQKN..FRLLIL.RTGSSFYQS...EYQSLFE...YHDSATF.QYT.IVIIFQELREMVSLLNRIVQYSQGK.........QV..V -------110-------120-------130-------140----- KNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGED |||||||||||| ||| |||||||||||||| ||||||| | KNVLKSFLRNKL..LLF....VTNKRDLKKMFQRL.DLSLEYG.D