Est3 Hansenula polymorpha telomerase subunit
GAMGPPSSRD AVRVTASAHM KHWLEPVLCE AGLGHNYKVD KVLKVLRIYP RSNTLSSLPL CLCDANYKIL AFANYKAIAA FERKERRRVT QNLLNSEIMI HSFTIRFYND DQVQGFFDGL KFKQKASLFP GYLVLEINDF SMFNRDQLIL SNAGTIEFLY GTPRYIARFI EQEFSDEE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.6 % (1839 of 2148) | 86.9 % (971 of 1118) | 81.7 % (688 of 842) | 95.7 % (180 of 188) |
Backbone | 97.0 % (1022 of 1054) | 96.4 % (345 of 358) | 97.3 % (511 of 525) | 97.1 % (166 of 171) |
Sidechain | 77.2 % (975 of 1263) | 81.8 % (622 of 760) | 70.0 % (340 of 486) | 76.5 % (13 of 17) |
Aromatic | 50.0 % (111 of 222) | 84.7 % (94 of 111) | 14.5 % (16 of 110) | 100.0 % (1 of 1) |
Methyl | 88.3 % (173 of 196) | 88.8 % (87 of 98) | 87.8 % (86 of 98) |
1. Est3
GAMGPPSSRD AVRVTASAHM KHWLEPVLCE AGLGHNYKVD KVLKVLRIYP RSNTLSSLPL CLCDANYKIL AFANYKAIAA FERKERRRVT QNLLNSEIMI HSFTIRFYND DQVQGFFDGL KFKQKASLFP GYLVLEINDF SMFNRDQLIL SNAGTIEFLY GTPRYIARFI EQEFSDEESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Est3 | natural abundance | 1.0 mM | |
17 | potassium chloride | natural abundance | 100 mM | |
18 | sodium phosphate | natural abundance | 50 mM | |
19 | DTT | natural abundance | 3 mM | |
20 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Est3 | natural abundance | 1.0 mM | |
17 | potassium chloride | natural abundance | 100 mM | |
18 | sodium phosphate | natural abundance | 50 mM | |
19 | DTT | natural abundance | 3 mM | |
20 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Est3 | natural abundance | 1.0 mM | |
17 | potassium chloride | natural abundance | 100 mM | |
18 | sodium phosphate | natural abundance | 50 mM | |
19 | DTT | natural abundance | 3 mM | |
20 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Est3 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | potassium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 50 mM | |
4 | DTT | natural abundance | 3 mM | |
5 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Est3 | [U-99% 13C; U-99% 15N] | 0.7 mM | |
7 | potassium chloride | natural abundance | 100 mM | |
8 | sodium phosphate | natural abundance | 50 mM | |
9 | DTT | natural abundance | 3 mM | |
10 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 700 MHz Equipped with quadruple resonance (1H, 13C, 15N, 31P) CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz Equipped with triple resonance (1H, 13C, 15N) probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details H2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Est3 | [U-99% 15N] | 0.8 mM | |
12 | potassium chloride | natural abundance | 100 mM | |
13 | sodium phosphate | natural abundance | 50 mM | |
14 | DTT | natural abundance | 3 mM | |
15 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27146_6q44.nef |
Input source #2: Coordindates | 6q44.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI -------110-------120-------130-------140-------150-------160-------170-------- HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 178 | 0 | 0 | 100.0 |
Content subtype: combined_27146_6q44.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI -------110-------120-------130-------140-------150-------160-------170-------- HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
53 | ASN | CG | 177.182 |
86 | ARG | CZ | 159.545 |
95 | ASN | CG | 177.805 |
164 | ARG | CZ | 159.489 |
168 | ARG | CZ | 159.445 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1118 | 952 | 85.2 |
13C chemical shifts | 842 | 671 | 79.7 |
15N chemical shifts | 200 | 183 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 358 | 347 | 96.9 |
13C chemical shifts | 356 | 344 | 96.6 |
15N chemical shifts | 171 | 168 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 760 | 605 | 79.6 |
13C chemical shifts | 486 | 327 | 67.3 |
15N chemical shifts | 29 | 15 | 51.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 102 | 93 | 91.2 |
13C chemical shifts | 102 | 93 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 87 | 78.4 |
13C chemical shifts | 110 | 4 | 3.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI -------110-------120-------130-------140-------150-------160-------170-------- HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGPPSSRDAVRVTASAHMKHWLEPVLCEAGLGHNYKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI |||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....................HWLEPVLCEAGLGH.YKVDKVLKVLRIYPRSNTLSSLPLCLCDANYKILAFANYKAIAAFERKERRRVTQNLLNSEIMI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------- HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFNRDQLILSNAGTIEFLYGTPRYIARFIEQEFSDEE |||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| |||||||||||| HSFTIRFYNDDQVQGFFDGLKFKQKASLFPGYLVLEINDFSMFN..QLILSNAGTIEFL.GTPRYIARFIEQ -------110-------120-------130-------140-------150-------160-------170--