Human Guanylate Kinase
HMSGPRPVVL SGPSGAGKST LLKRLLQEHS GIFGFSVSHT TRNPRPGEEN GKDYYFVTRE VMQRDIAAGD FIEHAEFSGN LYGTSKVAVQ AVQAMNRICV LDVDLQGVRN IKATDLRPIY ISVQPPSLHV LEQRLRQRNT ETEESLVKRL AAAQADMESS KEPGLFDVVI INDSLDQAYA ELKEALSEEI KKAQRTGA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.6 % (2095 of 2263) | 92.9 % (1096 of 1180) | 91.6 % (802 of 876) | 95.2 % (197 of 207) |
Backbone | 94.8 % (1109 of 1170) | 93.5 % (375 of 401) | 95.5 % (554 of 580) | 95.2 % (180 of 189) |
Sidechain | 91.4 % (1167 of 1277) | 92.6 % (721 of 779) | 89.4 % (429 of 480) | 94.4 % (17 of 18) |
Aromatic | 60.0 % (72 of 120) | 86.7 % (52 of 60) | 33.3 % (20 of 60) | |
Methyl | 99.6 % (227 of 228) | 99.1 % (113 of 114) | 100.0 % (114 of 114) |
1. hGMPK
HMSGPRPVVL SGPSGAGKST LLKRLLQEHS GIFGFSVSHT TRNPRPGEEN GKDYYFVTRE VMQRDIAAGD FIEHAEFSGN LYGTSKVAVQ AVQAMNRICV LDVDLQGVRN IKATDLRPIY ISVQPPSLHV LEQRLRQRNT ETEESLVKRL AAAQADMESS KEPGLFDVVI INDSLDQAYA ELKEALSEEI KKAQRTGASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 3 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | DSS | natural abundance | 5 uM |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | hGMPK | [U-100% 13C; U-100% 15N] | 1 mM | |
10 | sodium chloride | natural abundance | 100 mM | |
11 | sodium phosphate | natural abundance | 20 mM | |
12 | TCEP | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 3 mM | |
14 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, RDC restraints | combined_27151_6nui.nef |
Input source #2: Coordindates | 6nui.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------110-------120-------130-------140-------150-------160-------170-------180-------190------- LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA -------110-------120-------130-------140-------150-------160-------170-------180-------190--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 198 | 0 | 0 | 100.0 |
Content subtype: combined_27151_6nui.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV 0-------110-------120-------130-------140-------150-------160-------170-------180-------190------- LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
95 | ASN | CG | 178.112 |
109 | ASN | CG | 176.29 |
138 | ASN | CG | 177.71 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1180 | 1137 | 96.4 |
13C chemical shifts | 876 | 809 | 92.4 |
15N chemical shifts | 221 | 196 | 88.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 401 | 391 | 97.5 |
13C chemical shifts | 396 | 376 | 94.9 |
15N chemical shifts | 189 | 179 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 779 | 746 | 95.8 |
13C chemical shifts | 480 | 433 | 90.2 |
15N chemical shifts | 32 | 17 | 53.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 118 | 117 | 99.2 |
13C chemical shifts | 118 | 117 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 52 | 86.7 |
13C chemical shifts | 60 | 20 | 33.3 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||| .MSGPRPVVLSGPSGAGKSTLLKRLLQEHS.IFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEF.GNLYGTSKVAVQAVQAMNRICV 0-------110-------120-------130-------140-------150-------160-------170-------180-------190------- LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |||||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | LDVDLQGVRNIKAT.L.PIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRT.A
RDC restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 HMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICV |||| ||| |||| ||| |||||||||||| ||||||||||||||||||||||||| || || || || ||||||||||| .......VVLS.....GKS.LLKR.LQE..GIFGFSVSHTTR....GEENGKDYYFVTREVMQRDIAAGDF..HA..SG..YG...VA.QAVQAMNRICV 0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10 0-------110-------120-------130-------140-------150-------160-------170-------180-------190------- LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA ||| ||||||| || |||||| ||| || |||| || ||| ||| |||||| ||||||| |||||| |||| LDV.LQGVRNI...DL..IYISVQ.....VLE............SL.KRLA..QA...SSK..GLF.VVIIND..DQAYAEL.EALSEE.KKAQ 0-------110-------120-------130-------140-------150-------160-------170-------180-------190---