1H, 13C, 15N chemical shift assignments of initiation factor 1 from Clostridium difficile
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.7 % (788 of 1001) | 77.1 % (404 of 524) | 79.0 % (309 of 391) | 87.2 % (75 of 86) |
Backbone | 88.9 % (439 of 494) | 89.9 % (152 of 169) | 87.7 % (214 of 244) | 90.1 % (73 of 81) |
Sidechain | 71.6 % (419 of 585) | 71.0 % (252 of 355) | 73.3 % (165 of 225) | 40.0 % (2 of 5) |
Aromatic | 33.3 % (24 of 72) | 50.0 % (18 of 36) | 14.3 % (5 of 35) | 100.0 % (1 of 1) |
Methyl | 94.7 % (89 of 94) | 93.6 % (44 of 47) | 95.7 % (45 of 47) |
1. C difficile IF1
MASMAKKDVI ELEGTVSEAL PNAMFKVKLE NGHEILCHIS GKLRMNFIRI LEGDKVNVEL SPYDLTRGRI TWRKKLEHHH HHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C. difficile IF1 | [U-99% 15N] | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C. difficile IF1 | [U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Bruker AMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
3 | C. difficile IF1 | [U-99% 13C; U-99% 15N] | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27349_6c00.nef |
Input source #2: Coordindates | 6c00.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80 MASMAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MASMAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 83 | 0 | 0 | 100.0 |
Content subtype: combined_27349_6c00.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80 MASMAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLE -----------10--------20--------30--------40--------50--------60--------70----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 524 | 389 | 74.2 |
13C chemical shifts | 391 | 300 | 76.7 |
15N chemical shifts | 91 | 74 | 81.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 169 | 150 | 88.8 |
13C chemical shifts | 166 | 143 | 86.1 |
15N chemical shifts | 81 | 72 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 355 | 239 | 67.3 |
13C chemical shifts | 225 | 157 | 69.8 |
15N chemical shifts | 10 | 2 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 47 | 92.2 |
13C chemical shifts | 51 | 48 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 18 | 50.0 |
13C chemical shifts | 35 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80 MASMAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......KDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKK -----------10--------20--------30--------40--------50--------60--------70--
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80 MASMAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKKLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......DVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKK -----------10--------20--------30--------40--------50--------60--------70--