NMR assignments of Rous sarcoma virus matrix protein (M domain)
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.3 % (965 of 982) | 97.8 % (499 of 510) | 98.4 % (379 of 385) | 100.0 % (87 of 87) |
Backbone | 98.6 % (507 of 514) | 98.3 % (175 of 178) | 98.4 % (249 of 253) | 100.0 % (83 of 83) |
Sidechain | 98.0 % (536 of 547) | 97.6 % (324 of 332) | 98.6 % (208 of 211) | 100.0 % (4 of 4) |
Aromatic | 100.0 % (40 of 40) | 100.0 % (20 of 20) | 100.0 % (18 of 18) | 100.0 % (2 of 2) |
Methyl | 100.0 % (106 of 106) | 100.0 % (53 of 53) | 100.0 % (53 of 53) |
1. sRSV MA
SEAVIKVISS ACKTYCGKTS PSKKEIGAML SLLQKEGLLM SPSDLYSPGS WDPITAALSQ RAMILGKSGE LKTWGLVLGA LKAAREESolvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TCEP | natural abundance | 2 mM |
Solvent system 100% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
10 | sodium phosphate | natural abundance | 50 mM | |
11 | potassium chloride | natural abundance | 50 mM | |
12 | TCEP | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
6 | sodium phosphate | natural abundance | 50 mM | |
7 | sodium chloride | natural abundance | 50 mM | |
8 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | TCEP | natural abundance | 2 mM |
Bruker DMX - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 atm, Temperature 305 K, pH 6.000
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sRSV MA | [U-95% 13C; U-90% 15N] | .5 mM | |
10 | sodium phosphate | natural abundance | 50 mM | |
11 | potassium chloride | natural abundance | 50 mM | |
12 | TCEP | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_27396_6ccj.nef |
Input source #2: Coordindates | 6ccj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80------- SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 87 | 0 | 0 | 100.0 |
Content subtype: combined_27396_6ccj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------- SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
15 | TYR | CG | 130.026 |
34 | GLN | CD | 179.779 |
46 | TYR | CG | 129.839 |
60 | GLN | CD | 179.911 |
61 | ARG | CZ | 159.485 |
85 | ARG | CZ | 159.694 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 510 | 509 | 99.8 |
13C chemical shifts | 385 | 384 | 99.7 |
15N chemical shifts | 89 | 89 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 178 | 177 | 99.4 |
13C chemical shifts | 174 | 173 | 99.4 |
15N chemical shifts | 83 | 83 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 332 | 332 | 100.0 |
13C chemical shifts | 211 | 211 | 100.0 |
15N chemical shifts | 6 | 6 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 56 | 100.0 |
13C chemical shifts | 56 | 56 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 20 | 100.0 |
13C chemical shifts | 18 | 18 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80------- SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSGELKTWGLVLGALKAAREE