NMR assignments of Decorator, a phage-cementing 15 KDa monomer
GSHMANPNFT PSWPLYKDAD GVYVSALPIK AIKYANDGSA NAEFDGPYAD QYMSAQTVAV FKPEVGGYLF RSQYGELLYM SKTAFEANYT SASGSVANAE TADKLSTART ITLTGAVTGS ASFDGSANVT IETTSGS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.5 % (1211 of 1467) | 82.3 % (611 of 742) | 78.6 % (458 of 583) | 100.0 % (142 of 142) |
Backbone | 97.5 % (790 of 810) | 95.7 % (268 of 280) | 98.0 % (391 of 399) | 100.0 % (131 of 131) |
Sidechain | 69.4 % (543 of 782) | 74.2 % (343 of 462) | 61.2 % (189 of 309) | 100.0 % (11 of 11) |
Aromatic | 28.4 % (42 of 148) | 55.4 % (41 of 74) | 0.0 % (0 of 73) | 100.0 % (1 of 1) |
Methyl | 83.1 % (118 of 142) | 90.1 % (64 of 71) | 76.1 % (54 of 71) |
1. Decorator
GSHMANPNFT PSWPLYKDAD GVYVSALPIK AIKYANDGSA NAEFDGPYAD QYMSAQTVAV FKPEVGGYLF RSQYGELLYM SKTAFEANYT SASGSVANAE TADKLSTART ITLTGAVTGS ASFDGSANVT IETTSGSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details Two separate samples had their pH lowered to 2 for a period of 5 minutes before being raised to 4. The two samples were pooled together and lyophilized.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium acetate | natural abundance | 40 mM | |
6 | sodium chloride | natural abundance | 100 mM | |
7 | EDTA | natural abundance | 2 mM | |
8 | Decorator | [U-10% 13C; U-100% 15N] | 1 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details pH was raised to 4.05 after being unfolded at pH 1.97 for 2 minutes.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium acetate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 1 mM | |
12 | Decorator | [U-100% 15N] | 0.15 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The sample was unfolded to pH 2 for a period of time before being refolded at pH 4.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Decorator | [U-100% 13C; U-100% 15N; U-50% 2H] | 0.2 mM | |
14 | sodium acetate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | EDTA | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The pH of the sample was lowered to 2 for a brief period, before being raised to pH 4.02.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium acetate | natural abundance | 20 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | Decorator | [U-100% 13C; U-100% 15N; U-80% 2H] | 0.08 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details Two separate samples had their pH lowered to 2 for a period of 5 minutes before being raised to 4. The two samples were pooled together and lyophilized.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium acetate | natural abundance | 40 mM | |
6 | sodium chloride | natural abundance | 100 mM | |
7 | EDTA | natural abundance | 2 mM | |
8 | Decorator | [U-10% 13C; U-100% 15N] | 1 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details Two separate samples had their pH lowered to 2 for a period of 5 minutes before being raised to 4. The two samples were pooled together and lyophilized.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium acetate | natural abundance | 40 mM | |
6 | sodium chloride | natural abundance | 100 mM | |
7 | EDTA | natural abundance | 2 mM | |
8 | Decorator | [U-10% 13C; U-100% 15N] | 1 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details pH was raised to 4.05 after being unfolded at pH 1.97 for 2 minutes.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium acetate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 1 mM | |
12 | Decorator | [U-100% 15N] | 0.15 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details pH was raised to 4.05 after being unfolded at pH 1.97 for 2 minutes.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium acetate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | EDTA | natural abundance | 1 mM | |
12 | Decorator | [U-100% 15N] | 0.15 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 4, Details The sample was unfolded to pH 2 for a period of time before being refolded at pH 4.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | Decorator | [U-100% 13C; U-100% 15N; U-50% 2H] | 0.2 mM | |
14 | sodium acetate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | EDTA | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27435_6e3c.nef |
Input source #2: Coordindates | 6e3c.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
C | C | 137 | 0 | 0 | 100.0 |
Content subtype: combined_27435_6e3c.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GSHMANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE 100-------110-------120-------130---- TADKLSTARTITLTGAVTGSASFDGSANVTIETTSGS ||||||||||||||||||||||||||||||||||||| TADKLSTARTITLTGAVTGSASFDGSANVTIETTSGS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 742 | 611 | 82.3 |
13C chemical shifts | 583 | 460 | 78.9 |
15N chemical shifts | 144 | 141 | 97.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 280 | 275 | 98.2 |
13C chemical shifts | 274 | 274 | 100.0 |
15N chemical shifts | 131 | 130 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 462 | 336 | 72.7 |
13C chemical shifts | 309 | 186 | 60.2 |
15N chemical shifts | 13 | 11 | 84.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 64 | 86.5 |
13C chemical shifts | 74 | 53 | 71.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 39 | 52.7 |
13C chemical shifts | 73 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GSHMANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE ||| ||||||| |||||| ||||| || | ||||| ||| | ||||||||| |||||||||||| |||||||| ||||||||||||| ......PNF.PSWPLYK....VYVSAL.IKAIK.AN.G.ANAEF.....DQY.S.QTVAVFKPE.GGYLFRSQYGEL.YMSKTAFE.NYTSASGSVANAE -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120-------130---- TADKLSTARTITLTGAVTGSASFDGSANVTIETTSGS || ||| | | TA....TAR...L....................T 100-------110-------120-------130-
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GSHMANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....ANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE 100-------110-------120-------130---- TADKLSTARTITLTGAVTGSASFDGSANVTIETTSGS |||| ||||||||||||||||||||||||||| |||| TADK.STARTITLTGAVTGSASFDGSANVTIE.TSGS
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GSHMANPNFTPSWPLYKDADGVYVSALPIKAIKYANDGSANAEFDGPYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYTSASGSVANAE | | |||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| | | ...M...N...SWPLYKDADGVYVSALPIKAIKYANDGSANAEFD.PYADQYMSAQTVAVFKPEVGGYLFRSQYGELLYMSKTAFEANYT.....V...E -----------10--------20--------30--------40--------50--------60--------70--------80--------90------- 100-------110-------120-------130---- TADKLSTARTITLTGAVTGSASFDGSANVTIETTSGS |||| |||||| || | ||| || .ADKL...RTITLT..VT....F.....VTI.TT 100-------110-------120-------130-