Chemical shift assignment of the viral protein genome-linked (VPg) from Potato virus Y
GSSAYRKKGK GKGTTVGMGK SSRRFINMYG FDPTEYSFIQ FVDPLTGAQI EENVYADIRD IQERFSEVRK KMVENDDIEM QALGSNTTIH AYFRKDWSDK ALKIDLMPHN PLKVCDKTNG IAKFPERELE LRQTGPAVEV DVKDIPAQEV EHE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 71.5 % (1290 of 1805) | 67.8 % (643 of 949) | 73.9 % (515 of 697) | 83.0 % (132 of 159) |
Backbone | 79.6 % (720 of 904) | 76.1 % (236 of 310) | 80.6 % (361 of 448) | 84.2 % (123 of 146) |
Sidechain | 65.4 % (682 of 1043) | 63.2 % (404 of 639) | 68.8 % (269 of 391) | 69.2 % (9 of 13) |
Aromatic | 47.0 % (63 of 134) | 64.2 % (43 of 67) | 28.8 % (19 of 66) | 100.0 % (1 of 1) |
Methyl | 89.4 % (127 of 142) | 90.1 % (64 of 71) | 88.7 % (63 of 71) |
1. VPg from potato virus Y
GSSAYRKKGK GKGTTVGMGK SSRRFINMYG FDPTEYSFIQ FVDPLTGAQI EENVYADIRD IQERFSEVRK KMVENDDIEM QALGSNTTIH AYFRKDWSDK ALKIDLMPHN PLKVCDKTNG IAKFPERELE LRQTGPAVEV DVKDIPAQEV EHESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.02 % v/v |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
17 | sodium phosphate | natural abundance | 50 mM | |
18 | sodium chloride | natural abundance | 150 mM | |
19 | DTT | natural abundance | 1 mM | |
20 | sodium azide | natural abundance | 0.02 % v/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
17 | sodium phosphate | natural abundance | 50 mM | |
18 | sodium chloride | natural abundance | 150 mM | |
19 | DTT | natural abundance | 1 mM | |
20 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
17 | sodium phosphate | natural abundance | 50 mM | |
18 | sodium chloride | natural abundance | 150 mM | |
19 | DTT | natural abundance | 1 mM | |
20 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VPg from potato virus Y | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
12 | sodium phosphate | natural abundance | 50 mM | |
13 | sodium chloride | natural abundance | 150 mM | |
14 | DTT | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.02 % v/v |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VPg from potato virus Y | [U-13C; U-15N; U-2H] | 400 uM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.02 % v/v |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_27506_6nfw.nef |
Input source #2: Coordindates | 6nfw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPLTGAQIEENVYADIRDIQERF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPLTGAQIEENVYADIRDIQERF -------110-------120-------130-------140-------150-------160-------170-------180-------- SEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFPERELELRQTGPAVEVDVKDIPAQEVEHE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFPERELELRQTGPAVEVDVKDIPAQEVEHE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 188 | 0 | 0 | 100.0 |
Content subtype: combined_27506_6nfw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPLTGAQIEENVYADIRDIQERF |||||| ||||| ||||||||||||||||||||||||||||||| ......................................AYRKKG...GTTVG.................EYSFIQFVDPLTGAQIEENVYADIRDIQERF -------110-------120-------130-------140-------150-------160-------170-------180-------- SEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFPERELELRQTGPAVEVDVKDIPAQEVEHE |||||||||||||||||||||||||||| ||||||||||| |||||||||||||||||||||||||| |||||||||||||||||| SEVRKKMVENDDIEMQALGSNTTIHAYF...WSDKALKIDLM.HNPLKVCDKTNGIAKFPERELELRQT.PAVEVDVKDIPAQEVEHE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1184 | 571 | 48.2 |
13C chemical shifts | 862 | 481 | 55.8 |
15N chemical shifts | 211 | 123 | 58.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 382 | 215 | 56.3 |
13C chemical shifts | 376 | 233 | 62.0 |
15N chemical shifts | 181 | 115 | 63.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 802 | 356 | 44.4 |
13C chemical shifts | 486 | 248 | 51.0 |
15N chemical shifts | 30 | 8 | 26.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 88 | 66 | 75.0 |
13C chemical shifts | 88 | 64 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 38 | 42.7 |
13C chemical shifts | 88 | 17 | 19.3 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GKNKSKRIQALKFRHARDKRAGFEIDNNDDTIEEFFGSAYRKKGKGKGTTVGMGKSSRRFINMYGFDPTEYSFIQFVDPLTGAQIEENVYADIRDIQERF |||||||| ||||||||||||||||||||| ......................................................................YSFIQFVD.LTGAQIEENVYADIRDIQERF -------110-------120-------130-------140-------150-------160-------170-------180-------- SEVRKKMVENDDIEMQALGSNTTIHAYFRKDWSDKALKIDLMPHNPLKVCDKTNGIAKFPERELELRQTGPAVEVDVKDIPAQEVEHE ||||||||||||||||||| |||||||| || |||||||| |||||| |||||||||||||| | |||||||||||||||||| SEVRKKMVENDDIEMQALG.NTTIHAYF...WS.KALKIDLM..NPLKVC...NGIAKFPERELELR.T.PAVEVDVKDIPAQEVEHE