Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr27530_3.str

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: OK
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 149, Sequence coverage: 77.2%

     --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
     MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGY
       | |||||||||||||||||||||| |||||||||||||| |  |||| | ||| |||||| ||| |||  |||| || |||||| ||| |||||| | 
     ..D.LTEEQIAEFKEAFSLFDKDGDG.ITTKELGTVMRSLG.N..EAEL.D.INE.DADGNG.IDF.EFL..MARK.KD.DSEEEI.EAF.VFDKDG.G.
     
     -------110-------120-------130-------140---------
     ISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
     |||||| || || |||||| ||| |||||| |||| | ||     | ||
     ISAAEL.HV.TN.GEKLTD.EVD.MIREAD.DGDG.V.YE.....M.AK
     

   • Total number of assignments
     • ¹H chemical shifts: 115
     • ¹⁵N chemical shifts: 115
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	874	115	13.2
         15N chemical shifts	165	115	69.7

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	307	115	37.5
         15N chemical shifts	147	115	78.2

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	567	0	0.0
         15N chemical shifts	18	0	0.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	81	0	0.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	50	0	0.0

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1