Resonance assignment of human LARP4A La module
QSNSAVSTED LKECLKKQLE FCFSRENLSK DLYLISQMDS DQFIPIWTVA NMEEIKKLTT DPDLILEVLR SSPMVQVDEK GEKVRPSHKR CIVILREIPE TTPIEEVKGL FKSENCPKVI SCEFAHNSNW YITFQSDTDA QQAFKYLREE VKTFQGKPIM ARIKAINTFF AKNGYRLMD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 74.3 % (1622 of 2183) | 76.3 % (875 of 1147) | 69.3 % (586 of 846) | 84.7 % (161 of 190) |
Backbone | 78.6 % (832 of 1058) | 88.1 % (312 of 354) | 67.9 % (362 of 533) | 92.4 % (158 of 171) |
Sidechain | 73.2 % (951 of 1300) | 70.5 % (559 of 793) | 79.7 % (389 of 488) | 15.8 % (3 of 19) |
Aromatic | 48.2 % (79 of 164) | 48.8 % (40 of 82) | 46.3 % (37 of 80) | 100.0 % (2 of 2) |
Methyl | 93.1 % (175 of 188) | 92.6 % (87 of 94) | 93.6 % (88 of 94) |
1. LARP4A
QSNSAVSTED LKECLKKQLE FCFSRENLSK DLYLISQMDS DQFIPIWTVA NMEEIKKLTT DPDLILEVLR SSPMVQVDEK GEKVRPSHKR CIVILREIPE TTPIEEVKGL FKSENCPKVI SCEFAHNSNW YITFQSDTDA QQAFKYLREE VKTFQGKPIM ARIKAINTFF AKNGYRLMDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.25
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LARP4A | [U-100% 13C; U-100% 15N] | 400 uM | |
2 | LARP4A | [U-100% 15N] | 400 uM | |
3 | TRIS | natural abundance | 20 mM | |
4 | KCL | natural abundance | 100 mM | |
5 | DTT | natural abundance | 1 mM | |
6 | EDTA | natural abundance | 0.2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_27666_6i9b.nef |
Input source #2: Coordindates | 6i9b.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210 NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------220-------230-------240-------250-------260-------270-------280------- PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD -------110-------120-------130-------140-------150-------160-------170-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 177 | 0 | 0 | 100.0 |
Content subtype: combined_27666_6i9b.nef
Assigned chemical shifts
-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210 NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| .SAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPS...CIVILREIPETT -------220-------230-------240-------250-------260-------270-------280------- PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| ||||||||||| PIEEVKGLFKSENCPKVISCEFA.NSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAI..FFAKNGYRLMD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 839 | 543 | 64.7 |
1H chemical shifts | 1135 | 849 | 74.8 |
15N chemical shifts | 195 | 158 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 354 | 170 | 48.0 |
1H chemical shifts | 350 | 312 | 89.1 |
15N chemical shifts | 169 | 155 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 485 | 373 | 76.9 |
1H chemical shifts | 785 | 537 | 68.4 |
15N chemical shifts | 26 | 3 | 11.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 99 | 92 | 92.9 |
1H chemical shifts | 99 | 93 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 80 | 28 | 35.0 |
1H chemical shifts | 82 | 34 | 41.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210 NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| ||| ..AVSTEDLKECLKKQLEFCF.RENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSH..CIVILREI.ETT -------120-------130-------140-------150-------160-------170-------180-------190-------200-------210 -------220-------230-------240-------250-------260-------270-------280------- PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD ||||||||||| || |||||||| |||||||||||||||||||||||||||||||||||||||| | PIEEVKGLFKS.NC.KVISCEFA.NSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAI...F -------220-------230-------240-------250-------260-------270--------
Dihedral angle restraints
-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210 NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT ||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| NSAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSD.FIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPS..RCIVILREIPETT -------220-------230-------240-------250-------260-------270-------280------- PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAKNGYRLMD