Euprosthenops australis major ampullate spidroin 1 N-terminal domain (NTD) mutant at pH7
GSGNSHTTPW TNPGLAENFL NSFLQGLSSM PGFTASQLDD LSTIAQSLVQ SIQSLAAQGR TSPNKLQALN MAFASSLAEI AASEEGGGSL STKTSSIASA LSNAFLQTTG VVNQPFINEI TQLVSMFAQA GMNDVSA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.0 % (1295 of 1471) | 87.4 % (655 of 749) | 90.1 % (512 of 568) | 83.1 % (128 of 154) |
Backbone | 96.3 % (782 of 812) | 95.4 % (267 of 280) | 97.0 % (388 of 400) | 96.2 % (127 of 132) |
Sidechain | 81.0 % (636 of 785) | 82.7 % (388 of 469) | 84.0 % (247 of 294) | 4.5 % (1 of 22) |
Aromatic | 20.9 % (18 of 86) | 34.9 % (15 of 43) | 4.8 % (2 of 42) | 100.0 % (1 of 1) |
Methyl | 97.5 % (156 of 160) | 97.5 % (78 of 80) | 97.5 % (78 of 80) |
1. MaSp1 L6-NTD
GSGNSHTTPW TNPGLAENFL NSFLQGLSSM PGFTASQLDD LSTIAQSLVQ SIQSLAAQGR TSPNKLQALN MAFASSLAEI AASEEGGGSL STKTSSIASA LSNAFLQTTG VVNQPFINEI TQLVSMFAQA GMNDVSASolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MaSp1 L6-NTD | [U-13C; U-15N] | 300 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 200 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27683_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSGNSHTTPWTNPGLAENFLNSFLQGLSSMPGFTASQLDDLSTIAQSLVQSIQSLAAQGRTSPNKLQALNMAFASSLAEIAASEEGGGSLSTKTSSIASA || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GN.HTTPWTNPGLAENFLNSFLQGLSSMPGFTASQLDDLSTIAQSLVQSIQSLAAQGRTSPNKLQALNMAFASSLAEIAASEEGGGSLSTKTSSIASA -------110-------120-------130------- LSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA ||||||||||||||||||||||||||||||||||||| LSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 749 | 659 | 88.0 |
13C chemical shifts | 568 | 513 | 90.3 |
15N chemical shifts | 155 | 126 | 81.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 280 | 268 | 95.7 |
13C chemical shifts | 274 | 263 | 96.0 |
15N chemical shifts | 132 | 125 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 469 | 391 | 83.4 |
13C chemical shifts | 294 | 250 | 85.0 |
15N chemical shifts | 23 | 1 | 4.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 84 | 100.0 |
13C chemical shifts | 84 | 84 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 15 | 34.9 |
13C chemical shifts | 42 | 2 | 4.8 |
15N chemical shifts | 1 | 1 | 100.0 |