MtFKBP
GAMALERPEI DFPEGQPPEY LDITDITEGD GPEAVKGSNV SMHYVGVSWS TGEEFDASWN RGSTLDFTLG TGRVIKGWDM GIAGMKVGGR RKLVIPPHLA YGDRSPSPAI KPGETLIFVV DLVGVG
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.5 % (1317 of 1393) | 94.3 % (678 of 719) | 94.0 % (519 of 552) | 98.4 % (120 of 122) |
Backbone | 97.1 % (715 of 736) | 95.8 % (250 of 261) | 97.8 % (351 of 359) | 98.3 % (114 of 116) |
Sidechain | 92.5 % (707 of 764) | 93.4 % (428 of 458) | 91.0 % (273 of 300) | 100.0 % (6 of 6) |
Aromatic | 73.1 % (79 of 108) | 85.2 % (46 of 54) | 58.8 % (30 of 51) | 100.0 % (3 of 3) |
Methyl | 97.1 % (132 of 136) | 95.6 % (65 of 68) | 98.5 % (67 of 68) |
1. MtFKBP
GAMALERPEI DFPEGQPPEY LDITDITEGD GPEAVKGSNV SMHYVGVSWS TGEEFDASWN RGSTLDFTLG TGRVIKGWDM GIAGMKVGGR RKLVIPPHLA YGDRSPSPAI KPGETLIFVV DLVGVGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | nitrogen | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | nitrogen | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | nitrogen | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | nitrogen | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker DRX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PMSF | natural abundance | 2 mM | |
2 | EDTA | natural abundance | 5 mM | |
3 | sodium azide | natural abundance | 5 mM | |
4 | sodium chloride | natural abundance | 150 mM | |
5 | sodium phosphate | natural abundance | 50 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27690_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMALERPEIDFPEGQPPEYLDITDITEGDGPEAVKGSNVSMHYVGVSWSTGEEFDASWNRGSTLDFTLGTGRVIKGWDMGIAGMKVGGRRKLVIPPHLA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMALERPEIDFPEGQPPEYLDITDITEGDGPEAVKGSNVSMHYVGVSWSTGEEFDASWNRGSTLDFTLGTGRVIKGWDMGIAGMKVGGRRKLVIPPHLA -------110-------120------ YGDRSPSPAIKPGETLIFVVDLVGVG |||||||||||||||||||||||||| YGDRSPSPAIKPGETLIFVVDLVGVG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | PRO | N | 138.327 |
13 | PRO | N | 142.022 |
17 | PRO | N | 137.951 |
18 | PRO | N | 133.597 |
32 | PRO | N | 132.162 |
96 | PRO | N | 136.094 |
97 | PRO | N | 132.299 |
106 | PRO | N | 136.224 |
108 | PRO | N | 136.115 |
112 | PRO | N | 134.638 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 719 | 681 | 94.7 |
13C chemical shifts | 552 | 517 | 93.7 |
15N chemical shifts | 128 | 123 | 96.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 261 | 253 | 96.9 |
13C chemical shifts | 252 | 248 | 98.4 |
15N chemical shifts | 116 | 114 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 458 | 428 | 93.4 |
13C chemical shifts | 300 | 269 | 89.7 |
15N chemical shifts | 12 | 9 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 66 | 91.7 |
13C chemical shifts | 72 | 68 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 44 | 81.5 |
13C chemical shifts | 51 | 28 | 54.9 |
15N chemical shifts | 3 | 3 | 100.0 |