NMR resonance assignments of the hazelnut allergen isoform Cor a 1.0403
GVFCYEDEAT SVIPPARLFK SFVLDADNLI PKVAPQHFTG AENLEGNGGP GTIKKITFAE GSEFKYMKHK VEEIDHANFK YCYSIIEGGP LGHTLEKISY EIKMAAAPHG GGSILKITSK YHTKGNASIS EEEIKAGKEK AAGLFKAVEA YLLAHPDTYC
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.9 % (1690 of 1838) | 91.3 % (868 of 951) | 92.5 % (674 of 729) | 93.7 % (148 of 158) |
Backbone | 94.7 % (894 of 944) | 93.3 % (306 of 328) | 96.1 % (446 of 464) | 93.4 % (142 of 152) |
Sidechain | 90.0 % (934 of 1038) | 90.2 % (562 of 623) | 89.5 % (366 of 409) | 100.0 % (6 of 6) |
Aromatic | 75.6 % (130 of 172) | 75.6 % (65 of 86) | 75.6 % (65 of 86) | |
Methyl | 97.0 % (161 of 166) | 98.8 % (82 of 83) | 95.2 % (79 of 83) |
1. Cor a 1.0403
GVFCYEDEAT SVIPPARLFK SFVLDADNLI PKVAPQHFTG AENLEGNGGP GTIKKITFAE GSEFKYMKHK VEEIDHANFK YCYSIIEGGP LGHTLEKISY EIKMAAAPHG GGSILKITSK YHTKGNASIS EEEIKAGKEK AAGLFKAVEA YLLAHPDTYCSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Cor a 1.0403 | [U-99% 15N] | 0.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Cor a 1.0403 | [U-99% 15N] | 0.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Cor a 1.0403 | [U-99% 15N] | 0.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Cor a 1.0403 | [U-99% 15N] | 0.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Cor a 1.0403 | [U-99% 15N] | 0.5 mM | |
5 | sodium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Agilent DD2 - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Cor a 1.0403 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | DTT | natural abundance | 2 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr27967_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISY ||||||||||||| |||||||||||||||||||||||||||||||||||||||||| ||| || ||||||||||||||||||||||| ||||||||||| GVFCYEDEATSVI.PARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKI.FAE..EF.YMKHKVEEIDHANFKYCYSIIEG.PLGHTLEKISY -------110-------120-------130-------140-------150-------160 EIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| EIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
28 | ASN | CG | 176.488 |
36 | GLN | CD | 181.243 |
43 | ASN | CG | 175.065 |
47 | ASN | CG | 177.789 |
76 | HIS | ND1 | 227.803 |
76 | HIS | NE2 | 166.629 |
78 | ASN | CG | 177.431 |
93 | HIS | ND1 | 218.699 |
93 | HIS | NE2 | 167.172 |
109 | HIS | ND1 | 213.074 |
109 | HIS | NE2 | 171.122 |
122 | HIS | ND1 | 204.402 |
122 | HIS | NE2 | 191.19 |
126 | ASN | CG | 177.842 |
155 | HIS | ND1 | 173.941 |
155 | HIS | NE2 | 182.45 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 951 | 847 | 89.1 |
13C chemical shifts | 729 | 660 | 90.5 |
15N chemical shifts | 159 | 145 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 328 | 298 | 90.9 |
13C chemical shifts | 320 | 302 | 94.4 |
15N chemical shifts | 152 | 138 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 623 | 549 | 88.1 |
13C chemical shifts | 409 | 358 | 87.5 |
15N chemical shifts | 7 | 7 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 85 | 82 | 96.5 |
13C chemical shifts | 85 | 79 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 60 | 69.8 |
13C chemical shifts | 86 | 60 | 69.8 |