Backbone and sidechain 1H, 13C, and 15N Chemical Shift Assignments of RimP from E. coli
MSTLEQKLTE MITAPVEALG FELVGIEFIR GRTSTLRIYI DSEDGINVDD CADVSHQVSA VLDVEDPITV AYNLEVSSPG LDRPLFTAEH YARFVGEEVT LVLRMAVQNR RKWQGVIKAV DGEMITVTVE GKDEVFALSN IQKANLVPHF A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.3 % (1542 of 1727) | 89.2 % (785 of 880) | 89.7 % (612 of 682) | 87.9 % (145 of 165) |
Backbone | 96.8 % (867 of 896) | 96.4 % (295 of 306) | 97.7 % (434 of 444) | 94.5 % (138 of 146) |
Sidechain | 83.7 % (814 of 973) | 85.4 % (490 of 574) | 83.4 % (317 of 380) | 36.8 % (7 of 19) |
Aromatic | 11.1 % (12 of 108) | 22.2 % (12 of 54) | 0.0 % (0 of 53) | 0.0 % (0 of 1) |
Methyl | 93.9 % (199 of 212) | 93.4 % (99 of 106) | 94.3 % (100 of 106) |
1. RimP
MSTLEQKLTE MITAPVEALG FELVGIEFIR GRTSTLRIYI DSEDGINVDD CADVSHQVSA VLDVEDPITV AYNLEVSSPG LDRPLFTAEH YARFVGEEVT LVLRMAVQNR RKWQGVIKAV DGEMITVTVE GKDEVFALSN IQKANLVPHF ASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.6
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RimP | [U-98% 13C; U-98% 15N] | 600 uM | |
2 | HEPES | natural abundance | 10 mM | |
3 | MgCl2 | natural abundance | 6 mM | |
4 | NH4Cl | natural abundance | 30 mM | |
5 | TCEP | natural abundance | 75 uM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr28014_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSTLEQKLTEMITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...LEQKLTEMITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVT -------110-------120-------130-------140-------150- LVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHFA ||||||||||||||||||||||||||||||||||||||||||||||||||| LVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHFA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | GLN | CD | 180.071 |
57 | GLN | CD | 178.999 |
73 | ASN | CG | 176.387 |
108 | GLN | CD | 180.993 |
109 | ASN | CG | 178.603 |
114 | GLN | CD | 180.151 |
142 | GLN | CD | 179.038 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 880 | 783 | 89.0 |
13C chemical shifts | 682 | 612 | 89.7 |
15N chemical shifts | 165 | 145 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 306 | 295 | 96.4 |
13C chemical shifts | 302 | 295 | 97.7 |
15N chemical shifts | 146 | 138 | 94.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 574 | 488 | 85.0 |
13C chemical shifts | 380 | 317 | 83.4 |
15N chemical shifts | 19 | 7 | 36.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 110 | 104 | 94.5 |
13C chemical shifts | 110 | 105 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 12 | 22.2 |
13C chemical shifts | 53 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |