Amphiphysin SH3 in complex with Chikungunya virus nsP3 peptide
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.7 % (1045 of 1165) | 99.0 % (609 of 615) | 75.3 % (338 of 449) | 97.0 % (98 of 101) |
Backbone | 82.5 % (470 of 570) | 98.5 % (191 of 194) | 67.2 % (193 of 287) | 96.6 % (86 of 89) |
Sidechain | 97.1 % (666 of 686) | 99.3 % (418 of 421) | 93.3 % (236 of 253) | 100.0 % (12 of 12) |
Aromatic | 84.4 % (76 of 90) | 100.0 % (45 of 45) | 67.4 % (29 of 43) | 100.0 % (2 of 2) |
Methyl | 96.7 % (89 of 92) | 97.8 % (45 of 46) | 95.7 % (44 of 46) |
1. entity 1
GRLDLPPGFM FKVQAQHDYT ATDTDELQLK AGDVVLVIPF QNPEEQDEGW LMGVKESDWN QHKELEKCRG VFPENFTERV P2. entity 2
STVPVAPPRR RRGRNLTSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] amphiphysin 2 SH3, 0.5 mM [U-13C; U-15N] CHIKV nsP3 peptide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CHIKV nsP3 peptide | [U-13C; U-15N] | 0.5 mM | |
2 | amphiphysin 2 SH3 | [U-13C; U-15N] | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30010_5i22.nef |
Input source #2: Coordindates | 5i22.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----520-------530-------540-------550-------560-------570-------580-------590--- GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP --------10--------20--------30--------40--------50--------60--------70--------80-
--1730---1740---- STVPVAPPRRRRGRNLT ||||||||||||||||| STVPVAPPRRRRGRNLT --------10-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 81 | 0 | 0 | 100.0 |
B | B | 17 | 0 | 0 | 100.0 |
Content subtype: combined_30010_5i22.nef
Assigned chemical shifts
-----520-------530-------540-------550-------560-------570-------580-------590--- GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
--1730---1740---- STVPVAPPRRRRGRNLT ||||||||||||||||| STVPVAPPRRRRGRNLT
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
589 | THR | HG1 | 5.148 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 508 | 506 | 99.6 |
13C chemical shifts | 374 | 278 | 74.3 |
15N chemical shifts | 89 | 87 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 162 | 160 | 98.8 |
13C chemical shifts | 162 | 81 | 50.0 |
15N chemical shifts | 75 | 73 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 346 | 346 | 100.0 |
13C chemical shifts | 212 | 197 | 92.9 |
15N chemical shifts | 14 | 14 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 39 | 100.0 |
13C chemical shifts | 39 | 39 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 45 | 100.0 |
13C chemical shifts | 43 | 29 | 67.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 107 | 103 | 96.3 |
13C chemical shifts | 75 | 56 | 74.7 |
15N chemical shifts | 20 | 18 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 31 | 96.9 |
13C chemical shifts | 34 | 17 | 50.0 |
15N chemical shifts | 14 | 13 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 72 | 96.0 |
13C chemical shifts | 41 | 39 | 95.1 |
15N chemical shifts | 6 | 5 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 8 | 88.9 |
13C chemical shifts | 9 | 7 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
-----520-------530-------540-------550-------560-------570-------580-------590--- GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
--1730---1740---- STVPVAPPRRRRGRNLT |||||||||||||||| .TVPVAPPRRRRGRNLT
Dihedral angle restraints
-----520-------530-------540-------550-------560-------570-------580-------590--- GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| ...DLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMG.KESDWNQHKELEKCRGVFPENFTERVP