Solution Structure of human calcium-binding S100A9 (C3S) protein
MTSKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.0 % (1111 of 1372) | 78.8 % (570 of 723) | 83.5 % (439 of 526) | 82.9 % (102 of 123) |
Backbone | 90.5 % (612 of 676) | 86.6 % (201 of 232) | 93.1 % (311 of 334) | 90.9 % (100 of 110) |
Sidechain | 74.6 % (598 of 802) | 75.2 % (369 of 491) | 76.2 % (227 of 298) | 15.4 % (2 of 13) |
Aromatic | 0.0 % (0 of 102) | 0.0 % (0 of 51) | 0.0 % (0 of 50) | 0.0 % (0 of 1) |
Methyl | 92.0 % (92 of 100) | 92.0 % (46 of 50) | 92.0 % (46 of 50) |
1. entity 1
MTSKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTPSolvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Varian VNMRS - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 310 (±0.2) K, pH 7.5 (±0.05), Details 50 mM TRIS, 100 mM sodium chloride, 2 mM calcium chloride, 2 mM [U-13C; U-15N] S100A9 protein (C3S), 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S100A9 protein (C3S) | [U-13C; U-15N] | 2 (±0.2) mM | |
2 | TRIS | natural abundance | 50 (±0.2) mM | |
3 | calcium chloride | natural abundance | 2 (±0.2) mM | |
4 | sodium chloride | natural abundance | 100 (±0.2) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30017_5i8n.nef |
Input source #2: Coordindates | 5i8n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG -------110---- PGHHHKPGLGEGTP |||||||||||||| PGHHHKPGLGEGTP
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG -------110---- PGHHHKPGLGEGTP |||||||||||||| PGHHHKPGLGEGTP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
B | B | 114 | 0 | 0 | 100.0 |
Content subtype: combined_30017_5i8n.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ...KMSQLERNIETIINTFHQYSVKL..PDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWAS.EKMHEGDEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- PGHHHKPGLGEGTP ||||| ||||||| PGHHH.PGLGEGT -------110---
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 723 | 568 | 78.6 |
13C chemical shifts | 526 | 435 | 82.7 |
15N chemical shifts | 126 | 98 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 202 | 87.1 |
13C chemical shifts | 228 | 209 | 91.7 |
15N chemical shifts | 110 | 98 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 491 | 366 | 74.5 |
13C chemical shifts | 298 | 226 | 75.8 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 50 | 89.3 |
13C chemical shifts | 56 | 50 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 0 | 0.0 |
13C chemical shifts | 50 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ...KMSQLERNIETIINTFHQYSVKL..PDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWAS.EKMHEGDEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- PGHHHKPGLGEGTP | ||| ||||||| P.HHH.PGLGEGT -------110---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ...KMSQLERNIETIINTFHQYSVKL..PDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWAS.EKMHEGDEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- PGHHHKPGLGEGTP | ||| ||||||| P.HHH.PGLGEGT -------110---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||| ...KMSQLERNIETIINTFHQYSVKL..PDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWAS.EK.HEGDEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- PGHHHKPGLGEGTP ||||| ||||||| PGHHH.PGLGEGT -------110---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||| ...KMSQLERNIETIINTFHQYSVKL..PDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWAS.EK.HEGDEG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- PGHHHKPGLGEGTP ||||| ||||||| PGHHH.PGLGEGT -------110---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG |||||||||||||||| | |||||||||| | | ||||||||||| | ||||||||||||||||||| .......LERNIETIINTFHQYS........L.QGEFKELVRK......K..N..EKVIEHIMEDL.......L.FEEFIMLMARLTWASHEKM --------10--------20--------30--------40--------50--------60--------70--------80--------90---- -------110---- PGHHHKPGLGEGTP
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG -------110---- PGHHHKPGLGEGTP |||||||||||||| PGHHHKPGLGEGTP