NMR structure of antibacterial factor-2
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.7 % (609 of 728) | 91.3 % (348 of 381) | 71.9 % (200 of 278) | 88.4 % (61 of 69) |
Backbone | 80.1 % (322 of 402) | 95.1 % (135 of 142) | 64.6 % (126 of 195) | 93.8 % (61 of 65) |
Sidechain | 89.4 % (344 of 385) | 89.1 % (213 of 239) | 92.3 % (131 of 142) | 0.0 % (0 of 4) |
Aromatic | 88.9 % (16 of 18) | 88.9 % (8 of 9) | 88.9 % (8 of 9) | |
Methyl | 93.5 % (58 of 62) | 93.5 % (29 of 31) | 93.5 % (29 of 31) |
1. Antibacterial factor-related peptide 2
MDIDFSTCAR MDVPILKKAA QGLCITSCSM QNCGTGSCKK RSGRPTCVCY RCANGGGDIP LGALIKRGSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Antibacterial factor-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Antibacterial factor-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Antibacterial factor-2 | [U-100% 15N] | 1 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.7, Details 1 mM [U-100% 13C; U-100% 15N] Antibacterial factor-2, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Antibacterial factor-2 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30039_5ix5.nef |
Input source #2: Coordindates | 5ix5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:8:CYS:SG | A:38:CYS:SG | oxidized, CA 55.921, CB 40.692 ppm | oxidized, CA 53.877, CB 38.073 ppm | 2.005 |
A:24:CYS:SG | A:47:CYS:SG | oxidized, CA 57.337, CB 35.923 ppm | oxidized, CA 55.274, CB 35.344 ppm | 1.991 |
A:28:CYS:SG | A:49:CYS:SG | oxidized, CA 58.412, CB 36.576 ppm | oxidized, CA 51.827, CB 38.254 ppm | 1.911 |
A:33:CYS:SG | A:52:CYS:SG | oxidized, CA 55.823, CB 46.612 ppm | oxidized, CA 56.548, CB 42.816 ppm | 1.859 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60-------- MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 68 | 0 | 0 | 100.0 |
Content subtype: combined_30039_5ix5.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60-------- MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG ||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| MDIDFSTCARMDVPI.KKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 381 | 346 | 90.8 |
13C chemical shifts | 278 | 197 | 70.9 |
15N chemical shifts | 74 | 59 | 79.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 142 | 133 | 93.7 |
13C chemical shifts | 136 | 66 | 48.5 |
15N chemical shifts | 65 | 59 | 90.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 239 | 213 | 89.1 |
13C chemical shifts | 142 | 131 | 92.3 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 29 | 85.3 |
13C chemical shifts | 34 | 29 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 8 | 88.9 |
13C chemical shifts | 9 | 8 | 88.9 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60-------- MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG | ||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| M.IDFSTCARMDVPI.KKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60-------- MDIDFSTCARMDVPILKKAAQGLCITSCSMQNCGTGSCKKRSGRPTCVCYRCANGGGDIPLGALIKRG ||||||||||| ||||||||||||||||| |||||||||||||||||| ||| ||||||||| ...DFSTCARMDVP.LKKAAQGLCITSCSMQN.GTGSCKKRSGRPTCVCYR.ANG.GDIPLGALI --------10--------20--------30--------40--------50--------60-----