Cell surface anchoring domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.2 % (766 of 805) | 92.3 % (374 of 405) | 97.8 % (312 of 319) | 98.8 % (80 of 81) |
Backbone | 96.7 % (439 of 454) | 94.5 % (155 of 164) | 97.7 % (210 of 215) | 98.7 % (74 of 75) |
Sidechain | 93.5 % (387 of 414) | 90.0 % (217 of 241) | 98.2 % (164 of 167) | 100.0 % (6 of 6) |
Aromatic | 100.0 % (48 of 48) | 100.0 % (24 of 24) | 100.0 % (24 of 24) | |
Methyl | 93.3 % (97 of 104) | 90.4 % (47 of 52) | 96.2 % (50 of 52) |
1. Antifreeze protein
GNAIGFITKL DGSVTVQSIN GQERVLKLGD PIFFGETVLT GGSGSVTIAF VDGTDVVIGG DSIVEMTDEI YNTGDNSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | DSS | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | DSS | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | DSS | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.78 ppm | internal | direct | 1.0 |
15N | DSS | protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 20 mM TRIS, 50 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, 3 mM 13C MpAFP_RINM, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CaCl2 | natural abundance | 2 mM | |
2 | MgCl2 | natural abundance | 2 mM | |
3 | MpAFP_RINM | [U-13C] | 3 mM | |
4 | TRIS | natural abundance | 20 mM | |
5 | sodium chloride | natural abundance | 50 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30040_5ix9.nef |
Input source #2: Coordindates | 5ix9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------------------10--------20--------30--------40--------50--------60--------70--------80--------9 MSDNQFPFATLGNAIGFITKLDGSVTVQSINGQERVLKLGDPIFFGETVLTGGSGSVTIAFVDGTDVVIGGDSIVEMTDEIYNTGDNEDLVADSSSEIDA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSDNQFPFATLGNAIGFITKLDGSVTVQSINGQERVLKLGDPIFFGETVLTGGSGSVTIAFVDGTDVVIGGDSIVEMTDEIYNTGDNEDLVADSSSEIDA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------100-------110-------120-------130-------140-------150-------160-------170-------180---- LQNAILAGDDPTLIQDAPAAGNTLADQQRVDVSIERNDNSAQAGFGVDTQSSLPTYGYDTDNGNGGQATEREYSAPSLSRTLNQSPLLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LQNAILAGDDPTLIQDAPAAGNTLADQQRVDVSIERNDNSAQAGFGVDTQSSLPTYGYDTDNGNGGQATEREYSAPSLSRTLNQSPLLEHHHHHH -------110-------120-------130-------140-------150-------160-------170-------180-------190-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 195 | 0 | 0 | 100.0 |
Content subtype: combined_30040_5ix9.nef
Assigned chemical shifts
Distance restraints
Dihedral angle restraints