Murin CXCL13 solution structure featuring a folded N-terminal domain
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.8 % (938 of 1056) | 94.8 % (525 of 554) | 78.7 % (322 of 409) | 97.8 % (91 of 93) |
Backbone | 82.6 % (431 of 522) | 97.2 % (171 of 176) | 68.1 % (179 of 263) | 97.6 % (81 of 83) |
Sidechain | 95.0 % (588 of 619) | 93.7 % (354 of 378) | 97.0 % (224 of 231) | 100.0 % (10 of 10) |
Aromatic | 100.0 % (40 of 40) | 100.0 % (20 of 20) | 100.0 % (18 of 18) | 100.0 % (2 of 2) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. entity 1
MILEAHYTNL KCRCSGVIST VVGLNIIDRI QVTPPGNGCP KTEVVIWTKM KKVICVNPRA KWLQRLLRHV QSKSLSSTPQ APVSKRRAASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 850 uM U-[15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CXCL13 | [U-15N] | 850 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM [U-10% 13C; U-100% 15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CXCL13 | [U-10% 13C; U-100% 15N] | 280 uM | |
11 | potassium phosphate | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 850 uM U-[15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CXCL13 | [U-15N] | 850 uM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 950 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 950 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 600 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM [U-10% 13C; U-100% 15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CXCL13 | [U-10% 13C; U-100% 15N] | 280 uM | |
11 | potassium phosphate | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM [U-10% 13C; U-100% 15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CXCL13 | [U-10% 13C; U-100% 15N] | 280 uM | |
11 | potassium phosphate | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 700 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM [U-10% 13C; U-100% 15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | CXCL13 | [U-10% 13C; U-100% 15N] | 280 uM | |
11 | potassium phosphate | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | CXCL13 | [U-13C; U-15N] | 280 uM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | NaCl | natural abundance | 100 mM |
Bruker AvanceIII - 850 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6, Details 280 uM U-[13C,15N] CXCL13, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | CXCL13 | [U-13C; U-15N] | 280 uM | |
8 | potassium phosphate | natural abundance | 20 mM | |
9 | NaCl | natural abundance | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30042_5izb.nef |
Input source #2: Coordindates | 5izb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:12:CYS:SG | A:39:CYS:SG | oxidized, CA 54.556, CB 38.2 ppm | oxidized, CA 52.428, CB 41.847 ppm | 2.039 |
A:14:CYS:SG | A:55:CYS:SG | oxidized, CA 54.58, CB 42.811 ppm | oxidized, CA 57.382, CB 47.876 ppm | 2.027 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------- MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 89 | 0 | 0 | 100.0 |
Content subtype: combined_30042_5izb.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------- MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
48 | THR | HG1 | 5.893 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 554 | 524 | 94.6 |
13C chemical shifts | 409 | 309 | 75.6 |
15N chemical shifts | 100 | 91 | 91.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 176 | 171 | 97.2 |
13C chemical shifts | 178 | 85 | 47.8 |
15N chemical shifts | 83 | 81 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 378 | 353 | 93.4 |
13C chemical shifts | 231 | 224 | 97.0 |
15N chemical shifts | 17 | 10 | 58.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 61 | 100.0 |
13C chemical shifts | 61 | 61 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 20 | 100.0 |
13C chemical shifts | 18 | 18 | 100.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------- MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA |||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||| MILEAHYTNLKCRC.GVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQ...L..TPQAP --------10--------20--------30--------40--------50--------60--------70--------80--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------- MILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA |||||| ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| .ILEAHY..LKCRCSGVISTVVGLNIIDRIQVTP...GCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQ --------10--------20--------30--------40--------50--------60--------70-