Structure of anastellin bound to beta-strands A and B from the third type III domain of fibronectin
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.3 % (1070 of 1366) | 78.4 % (558 of 712) | 79.2 % (422 of 533) | 74.4 % (90 of 121) |
Backbone | 75.9 % (525 of 692) | 74.6 % (176 of 236) | 78.2 % (272 of 348) | 71.3 % (77 of 108) |
Sidechain | 80.9 % (634 of 784) | 80.3 % (382 of 476) | 81.0 % (239 of 295) | 100.0 % (13 of 13) |
Aromatic | 70.2 % (87 of 124) | 74.2 % (46 of 62) | 64.4 % (38 of 59) | 100.0 % (3 of 3) |
Methyl | 88.9 % (96 of 108) | 88.9 % (48 of 54) | 88.9 % (48 of 54) |
1. entity 1
GSQTTAPDAP PDPTVDQVDD TSIVVRWSRP2. entity 2
MRGSNAPQPS HISKYILRWR PKNSVGRWKE ATIPGHLNSY TIKGLKPGVV YEGQLISIQQ YGHQEVTRFD FTTTSTSTPG SRSHHHHHHSolvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | AB | natural abundance | 0.6 mM | |
20 | anastellin | [U-99% 15N] | 0.6 mM | |
21 | potassium chloride | natural abundance | 2.7 mM | |
22 | potassium phosphate | natural abundance | 1.8 mM | |
23 | sodium chloride | natural abundance | 140 mM | |
24 | sodium phosphate | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.755 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.755 ppm | internal | direct | 1.0 |
15N | water | protons | 4.755 ppm | internal | indirect | 0.1013291 |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 13C; U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | AB | [U-99% 13C; U-99% 15N] | 0.6 mM | |
2 | anastellin | natural abundance | 0.6 mM | |
3 | potassium chloride | natural abundance | 2.7 mM | |
4 | potassium phosphate | natural abundance | 1.8 mM | |
5 | sodium chloride | natural abundance | 140 mM | |
6 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 13C; U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | AB | natural abundance | 0.6 mM | |
8 | anastellin | [U-99% 13C; U-99% 15N] | 0.6 mM | |
9 | potassium chloride | natural abundance | 2.7 mM | |
10 | potassium phosphate | natural abundance | 1.8 mM | |
11 | sodium chloride | natural abundance | 140 mM | |
12 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM [U-99% 15N] AB, 0.6 mM anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | AB | [U-99% 15N] | 0.6 mM | |
14 | anastellin | natural abundance | 0.6 mM | |
15 | potassium chloride | natural abundance | 2.7 mM | |
16 | potassium phosphate | natural abundance | 1.8 mM | |
17 | sodium chloride | natural abundance | 140 mM | |
18 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | AB | natural abundance | 0.6 mM | |
20 | anastellin | [U-99% 15N] | 0.6 mM | |
21 | potassium chloride | natural abundance | 2.7 mM | |
22 | potassium phosphate | natural abundance | 1.8 mM | |
23 | sodium chloride | natural abundance | 140 mM | |
24 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | AB | natural abundance | 0.6 mM | |
20 | anastellin | [U-99% 15N] | 0.6 mM | |
21 | potassium chloride | natural abundance | 2.7 mM | |
22 | potassium phosphate | natural abundance | 1.8 mM | |
23 | sodium chloride | natural abundance | 140 mM | |
24 | sodium phosphate | natural abundance | 10 mM |
Agilent NMR system - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 100000 Pa, Temperature 298 K, pH 7.5, Details 0.6 mM AB, 0.6 mM [U-99% 15N] anastellin, 10 mM sodium phosphate, 1.8 mM potassium phosphate, 140 mM sodium chloride, 2.7 mM potassium chloride, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
19 | AB | natural abundance | 0.6 mM | |
20 | anastellin | [U-99% 15N] | 0.6 mM | |
21 | potassium chloride | natural abundance | 2.7 mM | |
22 | potassium phosphate | natural abundance | 1.8 mM | |
23 | sodium chloride | natural abundance | 140 mM | |
24 | sodium phosphate | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30061_5j6z.nef |
Input source #2: Coordindates | 5j6z.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30 GSQTTAPDAPPDPTVDQVDDTSIVVRWSRP |||||||||||||||||||||||||||||| GSQTTAPDAPPDPTVDQVDDTSIVVRWSRP
--------40--------50--------60--------70--------80--------90-------100-------110--------- MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 30 | 0 | 0 | 100.0 |
B | B | 89 | 0 | 0 | 100.0 |
Content subtype: combined_30061_5j6z.nef
Assigned chemical shifts
--------10--------20--------30 GSQTTAPDAPPDPTVDQVDDTSIVVRWSRP | ||||||||||||||| |||||||||||| G.QTTAPDAPPDPTVDQ.DDTSIVVRWSRP
--------40--------50--------60--------70--------80--------90-------100-------110--------- MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH | |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| M...NAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLK.GVVYEGQLISIQQYGHQEVTRFDF --------40--------50--------60--------70--------80--------90-------100-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 163 | 141 | 86.5 |
13C chemical shifts | 125 | 111 | 88.8 |
15N chemical shifts | 30 | 22 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 46 | 82.1 |
13C chemical shifts | 60 | 50 | 83.3 |
15N chemical shifts | 25 | 18 | 72.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 107 | 95 | 88.8 |
13C chemical shifts | 65 | 61 | 93.8 |
15N chemical shifts | 5 | 4 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 16 | 14 | 87.5 |
13C chemical shifts | 16 | 14 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 6 | 6 | 100.0 |
13C chemical shifts | 5 | 5 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 549 | 414 | 75.4 |
13C chemical shifts | 408 | 307 | 75.2 |
15N chemical shifts | 99 | 69 | 69.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 180 | 129 | 71.7 |
13C chemical shifts | 178 | 131 | 73.6 |
15N chemical shifts | 83 | 57 | 68.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 369 | 285 | 77.2 |
13C chemical shifts | 230 | 176 | 76.5 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 34 | 87.2 |
13C chemical shifts | 39 | 34 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 40 | 71.4 |
13C chemical shifts | 54 | 33 | 61.1 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30 GSQTTAPDAPPDPTVDQVDDTSIVVRWSRP || |||||| |||||||||||| ........AP.DPTVDQ.DDTSIVVRWSRP
--------40--------50--------60--------70--------80--------90-------100-------110--------- MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||| ....NAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLK.GVVYEGQLISIQQYGHQEVTRFDF --------40--------50--------60--------70--------80--------90-------100-
Dihedral angle restraints
--------40--------50--------60--------70--------80--------90-------100-------110--------- MRGSNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPGSRSHHHHHH |||||||||||||| ||||||||| ||||||||||||||||||||||||||||||||||| ..........HISKYILRWRPKNS..RWKEATIPG..NSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFT --------40--------50--------60--------70--------80--------90-------100--