Molecular basis for protein recognition specificity of the DYNLT1/Tctex1 canonical binding groove. Characterization of the interaction with activin receptor IIB
GSMEDYQAAE ETAFVVDEVS NIVKEAIESA IGGNAYQHSK VNQWTTNVVE QTLSQLTKLG KPFKYIVTCV IMQKNGAGLH TASSCFWDSS TDGSCTVRWE NKTMYCIVSA FGLSIGGGSG QSGPIKLGMA KITQVDFPPR EIV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.6 % (1292 of 1602) | 85.3 % (701 of 822) | 72.6 % (453 of 624) | 88.5 % (138 of 156) |
Backbone | 84.9 % (722 of 850) | 95.9 % (284 of 296) | 73.3 % (304 of 415) | 96.4 % (134 of 139) |
Sidechain | 78.8 % (694 of 881) | 79.3 % (417 of 526) | 80.8 % (273 of 338) | 23.5 % (4 of 17) |
Aromatic | 40.5 % (51 of 126) | 49.2 % (31 of 63) | 28.3 % (17 of 60) | 100.0 % (3 of 3) |
Methyl | 99.4 % (157 of 158) | 100.0 % (79 of 79) | 98.7 % (78 of 79) |
1. Dynein light chain Tctex-type 1,Cytoplasmic dynein 1 intermediate chain 2
GSMEDYQAAE ETAFVVDEVS NIVKEAIESA IGGNAYQHSK VNQWTTNVVE QTLSQLTKLG KPFKYIVTCV IMQKNGAGLH TASSCFWDSS TDGSCTVRWE NKTMYCIVSA FGLSIGGGSG QSGPIKLGMA KITQVDFPPR EIVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 50 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | DYNLT1/Tctex1-DIC chimera | natural abundance | 100 uM | |
4 | potassium phosphate | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DSS | natural abundance | 50 uM | |
8 | DTT | natural abundance | 1 mM | |
9 | DYNLT1/Tctex1-DIC chimera | [U-99% 15N] | 100 uM | |
10 | potassium phosphate | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 50 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | DYNLT1/Tctex1-DIC chimera | natural abundance | 100 uM | |
4 | potassium phosphate | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | DSS | natural abundance | 50 uM | |
8 | DTT | natural abundance | 1 mM | |
9 | DYNLT1/Tctex1-DIC chimera | [U-99% 15N] | 100 uM | |
10 | potassium phosphate | natural abundance | 100 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 50 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | DYNLT1/Tctex1-DIC chimera | natural abundance | 100 uM | |
4 | potassium phosphate | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM [U-99% 13C; U-99% 15N] DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | DSS | natural abundance | 50 uM | |
14 | DTT | natural abundance | 1 mM | |
15 | DYNLT1/Tctex1-DIC chimera | [U-99% 13C; U-99% 15N] | 100 uM | |
16 | potassium phosphate | natural abundance | 100 mM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz With triple resonance z-gradient cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 100 uM DYNLT1/Tctex1-DIC chimera, 100 mM potassium phosphate, 1 mM DTT, 50 uM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 50 uM | |
2 | DTT | natural abundance | 1 mM | |
3 | DYNLT1/Tctex1-DIC chimera | natural abundance | 100 uM | |
4 | potassium phosphate | natural abundance | 100 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30074_5jpw.nef |
Input source #2: Coordindates | 5jpw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE -------110-------120-------130-------140--- NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||||||||||||||||||||||||||| NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV
----150-------160-------170-------180-------190-------200-------210-------220-------230-------240--- GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ----250-------260-------270-------280------ NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||||||||||||||||||||||||||| NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV -------110-------120-------130-------140---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 143 | 0 | 0 | 100.0 |
B | B | 143 | 0 | 0 | 100.0 |
Content subtype: combined_30074_5jpw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE -------110-------120-------130-------140--- NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||||||||||||||||||||| |||| NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDF..REIV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 624 | 404 | 64.7 |
1H chemical shifts | 822 | 678 | 82.5 |
15N chemical shifts | 158 | 134 | 84.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 286 | 140 | 49.0 |
1H chemical shifts | 296 | 283 | 95.6 |
15N chemical shifts | 139 | 131 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 338 | 264 | 78.1 |
1H chemical shifts | 526 | 395 | 75.1 |
15N chemical shifts | 19 | 3 | 15.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 83 | 79 | 95.2 |
1H chemical shifts | 83 | 79 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 60 | 13 | 21.7 |
1H chemical shifts | 63 | 25 | 39.7 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||| ..MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQK..AGL.TASSCFWDSSTDGSCTVRWE -------110-------120-------130-------140--- NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||| ||||||||||||||||| |||| NKTMYCIVSAFGLSIGGGS.QSGPIKLGMAKITQVDF..REIV
----150-------160-------170-------180-------190-------200-------210-------220-------230-------240--- GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||||||||||||||||| ..MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQK..AGL.TASSCFWDSSTDGSCTVRWE ----250-------260-------270-------280------ NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||| ||||||||||||||||| |||| NKTMYCIVSAFGLSIGGGS.QSGPIKLGMAKITQVDF..REIV
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE -------110-------120-------130-------140--- NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||||||||||||||||||||||||||| NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV
----150-------160-------170-------180-------190-------200-------210-------220-------230-------240--- GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWE ----250-------260-------270-------280------ NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV ||||||||||||||||||||||||||||||||||||||||||| NKTMYCIVSAFGLSIGGGSGQSGPIKLGMAKITQVDFPPREIV