NMR solution structure of a thermophilic lysine methyl transferase from Sulfolobus islandicus
MSYVPHVPYV PTPEKVVRRM LEIAKVSQDD IVYALGCGDG RIIITAAKDF NVKKAVGVEI NDERIREALA NIEKNGVTGR ASIVKGNFFE VDISEATVVT MFLLTNVNEM LKPKLEKELK PGTRVVSHEF EIRGWNPKEV IKVEDGNMNH TVYLYVIGEH KAAALEHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.6 % (1606 of 2018) | 78.0 % (815 of 1045) | 80.3 % (639 of 796) | 85.9 % (152 of 177) |
Backbone | 89.8 % (914 of 1018) | 89.7 % (312 of 348) | 89.3 % (451 of 505) | 91.5 % (151 of 165) |
Sidechain | 71.8 % (834 of 1161) | 72.2 % (503 of 697) | 73.0 % (330 of 452) | 8.3 % (1 of 12) |
Aromatic | 31.0 % (44 of 142) | 33.8 % (24 of 71) | 27.1 % (19 of 70) | 100.0 % (1 of 1) |
Methyl | 88.2 % (194 of 220) | 89.1 % (98 of 110) | 87.3 % (96 of 110) |
1. Protein-lysine N-methyltransferase
MSYVPHVPYV PTPEKVVRRM LEIAKVSQDD IVYALGCGDG RIIITAAKDF NVKKAVGVEI NDERIREALA NIEKNGVTGR ASIVKGNFFE VDISEATVVT MFLLTNVNEM LKPKLEKELK PGTRVVSHEF EIRGWNPKEV IKVEDGNMNH TVYLYVIGEH KAAALEHHHH HHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DSS | natural abundance | 0.5 mM | |
7 | Na-acetate | natural abundance | 20 mM | |
8 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 0.123 M C12E5, 0.111 M hexanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | C12E5 | natural abundance | 0.123 M | |
12 | DSS | natural abundance | 0.5 mM | |
13 | Na-acetate | natural abundance | 20 mM | |
14 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
15 | hexanol | natural abundance | 0.111 M | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DSS | natural abundance | 0.5 mM | |
2 | Na-acetate | natural abundance | 20 mM | |
3 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DSS | natural abundance | 0.5 mM | |
7 | Na-acetate | natural abundance | 20 mM | |
8 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DSS | natural abundance | 0.5 mM | |
7 | Na-acetate | natural abundance | 20 mM | |
8 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 800 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 0.123 M C12E5, 0.111 M hexanol, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | C12E5 | natural abundance | 0.123 M | |
12 | DSS | natural abundance | 0.5 mM | |
13 | Na-acetate | natural abundance | 20 mM | |
14 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
15 | hexanol | natural abundance | 0.111 M | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DSS | natural abundance | 0.5 mM | |
7 | Na-acetate | natural abundance | 20 mM | |
8 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5, Details 1 mM [U-100% 13C; U-100% 15N] aKMT_D34A, 20 mM Na-acetate, 0.5 mM DSS, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DSS | natural abundance | 0.5 mM | |
7 | Na-acetate | natural abundance | 20 mM | |
8 | aKMT_D34A | [U-100% 13C; U-100% 15N] | 1 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_30087_5jwj.nef |
Input source #2: Coordindates | 5jwj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT -------110-------120-------130-------140-------150-------160-------170-- MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 172 | 0 | 0 | 100.0 |
Content subtype: combined_30087_5jwj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....PHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-- MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFL......MLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALE -------110-------120-------130-------140-------150-------160------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | PRO | N | 109.982 |
11 | PRO | N | 133.622 |
121 | PRO | N | 137.692 |
137 | PRO | N | 138.999 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 796 | 631 | 79.3 |
1H chemical shifts | 1045 | 803 | 76.8 |
15N chemical shifts | 185 | 150 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 344 | 308 | 89.5 |
1H chemical shifts | 348 | 312 | 89.7 |
15N chemical shifts | 165 | 149 | 90.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 452 | 323 | 71.5 |
1H chemical shifts | 697 | 491 | 70.4 |
15N chemical shifts | 20 | 1 | 5.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 115 | 96 | 83.5 |
1H chemical shifts | 115 | 99 | 86.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 70 | 17 | 24.3 |
1H chemical shifts | 71 | 22 | 31.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| .....HVPYVPT.EKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGN.FEVDISEATVVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-- MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| MFL......MLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKA -------110-------120-------130-------140-------150-------160--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......VPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-- MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH |||| ||||||||||||||||||||||||||||||||||||||||||||||||| MFLL.......KPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEH -------110-------120-------130-------140-------150-------160
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYALGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVT | | | ||| | | ||||||| ||| || ||| || ||||| |||| | ||| | ||| | ||||||||||||| || ||||||| || .....H...V.T.EKV..R.L.IAKVSQD.IVY.LG.GDG.II.TAAKD.NVKK..G.EIN.E....ALA.I.KNGVTGRASIVKG.FF.VDISEAT.VT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-- MFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHKAAALEHHHHHH || | ||||| |||||| |||||||| || | ||||||||| |||| | || .........ML..K.EKELK.GTRVVS.EFEIRGWN.KE..K.EDGNMNHTV.LYVI.E.KA -------110-------120-------130-------140-------150-------160--