NMR structure of foldswitch-stablized KaiB from Thermosynechococcus elongatus
MAPLRKTAVL KLYVAGNTPN SVRALKTLAN ILEKEFKGVY ALKVIDVLKN PQLAEEDKIL ATPTLAKVLP PPVRRIIGDL SNREKVLIAL RLLAEEIGDY KDDDDK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.5 % (1169 of 1264) | 91.4 % (604 of 661) | 93.8 % (467 of 498) | 93.3 % (98 of 105) |
Backbone | 97.3 % (605 of 622) | 96.7 % (202 of 209) | 97.5 % (306 of 314) | 98.0 % (97 of 99) |
Sidechain | 89.2 % (664 of 744) | 88.9 % (402 of 452) | 91.3 % (261 of 286) | 16.7 % (1 of 6) |
Aromatic | 0.0 % (0 of 34) | 0.0 % (0 of 17) | 0.0 % (0 of 17) | |
Methyl | 97.6 % (160 of 164) | 97.6 % (80 of 82) | 97.6 % (80 of 82) |
1. Circadian clock protein KaiB
MAPLRKTAVL KLYVAGNTPN SVRALKTLAN ILEKEFKGVY ALKVIDVLKN PQLAEEDKIL ATPTLAKVLP PPVRRIIGDL SNREKVLIAL RLLAEEIGDY KDDDDKSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 300 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 300 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 356 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 356 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 601.13 MHz | internal | indirect | 1.0 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 300 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 300 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 356 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 356 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 356 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 356 uM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 300 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 300 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 99.96% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 99.96% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
5 | H2O | natural abundance | 0.04 % | |
6 | D2O | natural abundance | 99.96 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7, Details 800 uM [U-99% 13C; U-99% 15N] KaiB mutant in foldswitched state, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KaiB mutant in foldswitched state | [U-99% 13C; U-99% 15N] | 800 uM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_30091_5jyt.nef |
Input source #2: Coordindates | 5jyt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY ------ KDDDDK |||||| KDDDDK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 106 | 0 | 0 | 100.0 |
Content subtype: combined_30091_5jyt.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY ------ KDDDDK |||||| KDDDDK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 661 | 603 | 91.2 |
13C chemical shifts | 498 | 466 | 93.6 |
15N chemical shifts | 111 | 97 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 209 | 204 | 97.6 |
13C chemical shifts | 212 | 206 | 97.2 |
15N chemical shifts | 99 | 97 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 452 | 399 | 88.3 |
13C chemical shifts | 286 | 260 | 90.9 |
15N chemical shifts | 12 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 79 | 95.2 |
13C chemical shifts | 83 | 79 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 0 | 0.0 |
13C chemical shifts | 17 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ KDDDDK || || KD.DD -----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....KTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------ KDDDDK ||||| KDDDD -----
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAPLRKTAVLKLYVAGNTPNSVRALKTLANILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIALRLLAEEIGDY |||||||| |||||||||||||| |||||||| ||||| ||||| ||||||||||||| ........VLKLYVAG..PNSVRALKTLANIL......VYALKVID......LAEED.....PTLAK...............REKVLIALRLLAE --------10--------20--------30--------40--------50--------60--------70--------80--------90----- ------ KDDDDK