Solution structure of the yeast Ddi1 HDD domain
GPLGSATLSD EAFIEQFRQE LLNNQMLRSQ LILQIPGLND LVNDPLLFRE RLGPLILQRR YGGYNTAMNP FGIPQDEYTR LMANPDDPDN KKRIAELLDQ QAIDEQLRNA IEYTPE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.5 % (1353 of 1388) | 98.2 % (721 of 734) | 96.2 % (508 of 528) | 98.4 % (124 of 126) |
Backbone | 99.0 % (671 of 678) | 98.7 % (227 of 230) | 99.1 % (338 of 341) | 99.1 % (106 of 107) |
Sidechain | 96.6 % (791 of 819) | 98.0 % (494 of 504) | 94.3 % (279 of 296) | 94.7 % (18 of 19) |
Aromatic | 77.8 % (56 of 72) | 100.0 % (36 of 36) | 55.6 % (20 of 36) | |
Methyl | 100.0 % (130 of 130) | 100.0 % (65 of 65) | 100.0 % (65 of 65) |
1. entity 1
GPLGSATLSD EAFIEQFRQE LLNNQMLRSQ LILQIPGLND LVNDPLLFRE RLGPLILQRR YGGYNTAMNP FGIPQDEYTR LMANPDDPDN KKRIAELLDQ QAIDEQLRNA IEYTPESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Ddi1 86-196-2 | [U-15N] | 0.5 (±0.1) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Ddi1 86-196-2 | [U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 600 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Ddi1 86-196-2 | [U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 600 MHz RT probe
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Ddi1 86-196-2 | [U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 600 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 600 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 850 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 850 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 600 MHz RT probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
2 | Ddi1 86-196-2 | [U-15N] | 0.5 (±0.1) mM |
Bruker Avance - 850 MHz cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] Ddi1 86-196, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Ddi1 86-196-1 | [U-13C; U-15N] | 0.5 (±0.1) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_30102_5kes.nef |
Input source #2: Coordindates | 5kes.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------190------ QAIDEQLRNAIEYTPE |||||||||||||||| QAIDEQLRNAIEYTPE -------110------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_30102_5kes.nef
Assigned chemical shifts
--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .PLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ -------190------ QAIDEQLRNAIEYTPE |||||||||||||||| QAIDEQLRNAIEYTPE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 734 | 721 | 98.2 |
13C chemical shifts | 528 | 507 | 96.0 |
15N chemical shifts | 135 | 126 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 230 | 227 | 98.7 |
13C chemical shifts | 232 | 229 | 98.7 |
15N chemical shifts | 107 | 106 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 504 | 494 | 98.0 |
13C chemical shifts | 296 | 278 | 93.9 |
15N chemical shifts | 28 | 20 | 71.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 68 | 100.0 |
13C chemical shifts | 68 | 68 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 36 | 100.0 |
13C chemical shifts | 36 | 19 | 52.8 |
Distance restraints
--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| .......LSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRY.......NPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ --------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 -------190------ QAIDEQLRNAIEYTPE |||||||||| QAIDEQLRNA -------190
Dihedral angle restraints
--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ ||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ........SDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRY........PFGIPQDEYTRLMANPDDPDNKKRIAELLDQ --------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 -------190------ QAIDEQLRNAIEYTPE |||||||||| QAIDEQLRNA -------190
RDC restraints
--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 GPLGSATLSDEAFIEQFRQELLNNQMLRSQLILQIPGLNDLVNDPLLFRERLGPLILQRRYGGYNTAMNPFGIPQDEYTRLMANPDDPDNKKRIAELLDQ |||| ||||||||||| ||||||||| |||||||| | |||||| ||||||| ||| |||||| ||| || |||||||||||| .........DEAF.EQFRQELLNNQ.LRSQLILQI.GLNDLVND.L.FRERLG.LILQRRY.........FGI.QDEYTR.MAN.DD.DNKKRIAELLDQ --------90-------100-------110-------120-------130-------140-------150-------160-------170-------180 -------190------ QAIDEQLRNAIEYTPE | ||||| Q.IDEQL -------