Solution Structure of a repacked version of HIF-2 alpha PAS-B (CASP target)
GEFLDSKTFL SRFSMDMKFT YCDDRITELI GYHPEELLGR SASEFWHALD SENMTKSHQN LCTKGQVVSG QYRMLAKHGG YVWLETQMTV IYNPRNLQPQ CIMAVNYVLS EIEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.6 % (1302 of 1362) | 95.6 % (677 of 708) | 95.3 % (505 of 530) | 96.8 % (120 of 124) |
Backbone | 95.4 % (647 of 678) | 95.7 % (222 of 232) | 94.6 % (317 of 335) | 97.3 % (108 of 111) |
Sidechain | 96.1 % (760 of 791) | 95.6 % (455 of 476) | 97.0 % (293 of 302) | 92.3 % (12 of 13) |
Aromatic | 97.1 % (134 of 138) | 97.1 % (67 of 69) | 97.0 % (65 of 67) | 100.0 % (2 of 2) |
Methyl | 94.5 % (104 of 110) | 92.7 % (51 of 55) | 96.4 % (53 of 55) |
1. Endothelial PAS domain-containing protein 1
GEFLDSKTFL SRFSMDMKFT YCDDRITELI GYHPEELLGR SASEFWHALD SENMTKSHQN LCTKGQVVSG QYRMLAKHGG YVWLETQMTV IYNPRNLQPQ CIMAVNYVLS EIEKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.5 mM [U-99% 13C; U-99% 15N] HIF-2 alpha D1, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HIF-2 alpha D1 | [U-99% 13C; U-99% 15N] | 0.5 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | Tris | natural abundance | 50 mM | |
5 | NaCl | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30118_5kiz.nef |
Input source #2: Coordindates | 5kiz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--240-------250-------260-------270-------280-------290-------300-------310-------320-------330----- GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --340--------- CIMAVNYVLSEIEK |||||||||||||| CIMAVNYVLSEIEK -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_30118_5kiz.nef
Assigned chemical shifts
--240-------250-------260-------270-------280-------290-------300-------310-------320-------330----- GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ --340--------- CIMAVNYVLSEIEK |||||||||||||| CIMAVNYVLSEIEK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
262 | THR | HG1 | 0.984 |
290 | THR | HG1 | 5.5183 |
321 | THR | HG1 | 6.1304 |
324 | THR | HG1 | 5.7848 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 708 | 691 | 97.6 |
13C chemical shifts | 530 | 505 | 95.3 |
15N chemical shifts | 129 | 122 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 232 | 226 | 97.4 |
13C chemical shifts | 228 | 207 | 90.8 |
15N chemical shifts | 111 | 108 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 476 | 465 | 97.7 |
13C chemical shifts | 302 | 298 | 98.7 |
15N chemical shifts | 18 | 14 | 77.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 61 | 100.0 |
13C chemical shifts | 61 | 61 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 67 | 97.1 |
13C chemical shifts | 67 | 65 | 97.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--240-------250-------260-------270-------280-------290-------300-------310-------320-------330----- GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .EFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ --340--------- CIMAVNYVLSEIEK |||||||||||||| CIMAVNYVLSEIEK
Dihedral angle restraints
--240-------250-------260-------270-------280-------290-------300-------310-------320-------330----- GEFLDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||| ...LDSKTFLSRFSMDMKFTYCDDRITELIGYHPEELLGRSASEFWHALDSENMTKSHQN.CTKGQVVSGQYRMLAKHGGYVWLETQMTVIYNPRNLQPQ --340--------- CIMAVNYVLSEIEK |||||||||||||| CIMAVNYVLSEIEK