Solution NMR Structure of Denovo Beta Sheet Design Protein, Northeast Structural Genomics Consortium (NESG) Target OR664
MQDIVEAAKQ AAIAIFQLWK NPTDPEAQEL LNKILSPDVL DQVREHAREL QKQGIHFEVK RVEVTTDGNT VNVTVELEET TGGTTTNTTY ELRFEVDGDT IRRVTVTQNG GSLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.3 % (1156 of 1371) | 91.1 % (643 of 706) | 73.5 % (392 of 533) | 91.7 % (121 of 132) |
Backbone | 77.6 % (554 of 714) | 90.2 % (220 of 244) | 64.3 % (227 of 353) | 91.5 % (107 of 117) |
Sidechain | 92.1 % (709 of 770) | 91.6 % (423 of 462) | 92.8 % (272 of 293) | 93.3 % (14 of 15) |
Aromatic | 65.9 % (54 of 82) | 65.9 % (27 of 41) | 65.0 % (26 of 40) | 100.0 % (1 of 1) |
Methyl | 100.0 % (152 of 152) | 100.0 % (76 of 76) | 100.0 % (76 of 76) |
1. entity 1
MQDIVEAAKQ AAIAIFQLWK NPTDPEAQEL LNKILSPDVL DQVREHAREL QKQGIHFEVK RVEVTTDGNT VNVTVELEET TGGTTTNTTY ELRFEVDGDT IRRVTVTQNG GSLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Bruker AVENCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.01) atm, Temperature 298 (±0.2) K, pH 7.4 (±0.05), Details 1.27 mM [U-99% 13C; U-99% 15N] OR664, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | OR664 | [U-99% 13C; U-99% 15N] | 1.27 (±0.1) mM | |
2 | NaCl | natural abundance | 137 mM | |
3 | KCl | natural abundance | 2.7 mM | |
4 | Na2HPO4 | natural abundance | 10 mM | |
5 | KH2PO4 | natural abundance | 1.8 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30128_5kpe.nef |
Input source #2: Coordindates | 5kpe.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT -------110-------120 IRRVTVTQNGGSLEHHHHHH |||||||||||||||||||| IRRVTVTQNGGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 120 | 0 | 0 | 100.0 |
Content subtype: combined_30128_5kpe.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETT.GTTTNTTYELRFEVDGDT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 IRRVTVTQNGGSLEHHHHHH |||||||||||||| IRRVTVTQNGGSLE -------110----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 706 | 650 | 92.1 |
13C chemical shifts | 533 | 384 | 72.0 |
15N chemical shifts | 138 | 121 | 87.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 224 | 91.8 |
13C chemical shifts | 240 | 112 | 46.7 |
15N chemical shifts | 117 | 107 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 462 | 426 | 92.2 |
13C chemical shifts | 293 | 272 | 92.8 |
15N chemical shifts | 21 | 14 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 77 | 100.0 |
13C chemical shifts | 77 | 77 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 27 | 65.9 |
13C chemical shifts | 40 | 26 | 65.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETT.GTTTNTTYELRFEVDGDT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 IRRVTVTQNGGSLEHHHHHH |||||||||| ||| IRRVTVTQNG.SLE -------110----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MQDIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQGIHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| ..DIVEAAKQAAIAIFQLWKNPTDPEAQELLNKILSPDVLDQVREHARELQKQ.IHFEVKRVEVTTDGNTVNVTVELEETTGGTTTNTTYELRFEVDGDT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120 IRRVTVTQNGGSLEHHHHHH |||||||| IRRVTVTQ --------