Identification and structural characterization of LytU
GSKWEDFFRG SRITETFGKY QHSPFDGKHY GIDFALPKGT PIKAPTNGKV TRIFNNELGG KVLQIAEDNG EYHQWYLHLD KYNVKVGDRV KAGDIIAYSG NTGIQTTGAH LHFQRMKGGV GNAYAEDPKP FIDQLPDGER SLYDL
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:HIS29:NE2 | 2:ZN1:ZN |
2 | na | sing | 1:ASP33:OD1 | 2:ZN1:ZN |
3 | na | sing | 1:ASP33:OD2 | 2:ZN1:ZN |
4 | na | sing | 1:HIS112:ND1 | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.2 % (1467 of 1701) | 94.6 % (839 of 887) | 74.7 % (494 of 661) | 87.6 % (134 of 153) |
Backbone | 80.1 % (686 of 856) | 91.4 % (276 of 302) | 69.2 % (288 of 416) | 88.4 % (122 of 138) |
Sidechain | 93.3 % (906 of 971) | 96.2 % (563 of 585) | 89.2 % (331 of 371) | 80.0 % (12 of 15) |
Aromatic | 82.3 % (158 of 192) | 97.9 % (94 of 96) | 66.0 % (62 of 94) | 100.0 % (2 of 2) |
Methyl | 100.0 % (128 of 128) | 100.0 % (64 of 64) | 100.0 % (64 of 64) |
1. entity 1
GSKWEDFFRG SRITETFGKY QHSPFDGKHY GIDFALPKGT PIKAPTNGKV TRIFNNELGG KVLQIAEDNG EYHQWYLHLD KYNVKVGDRV KAGDIIAYSG NTGIQTTGAH LHFQRMKGGV GNAYAEDPKP FIDQLPDGER SLYDLSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 46.01 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.79 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 46.01 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.79 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 46.01 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 117.79 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 308 K, pH 6.5, Details 0.5 mM [U-13C; U-15N] LytU, 20 mM bisTris buffer, 1.25 mM zinc chloride, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LytU | [U-13C; U-15N] | 0.5 mM | |
2 | bisTris buffer | 20 mM | ||
3 | zinc chloride | 1.25 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_30131_5kqc.nef |
Input source #2: Coordindates | 5kqc.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:29:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:33:ASP:OD1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:33:ASP:OD2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:112:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--50-------60--------70--------80--------90-------100-------110-------120-------130-------140------- GSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 150-------160-------170-------180-------190-- NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL ||||||||||||||||||||||||||||||||||||||||||||| NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL -------110-------120-------130-------140-----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 145 | 0 | 0 | 100.0 |
Content subtype: combined_30131_5kqc.nef
Assigned chemical shifts
--50-------60--------70--------80--------90-------100-------110-------120-------130-------140------- GSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG ||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| .SKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNN.LGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG 150-------160-------170-------180-------190-- NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL || | |||||||||||||||||||||||||||||||||||||||| NT.I.TTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
76 | HIS | HD1 | 11.553 |
87 | THR | HG1 | 6.183 |
98 | THR | HG1 | 5.682 |
120 | HIS | HE2 | 11.071 |
125 | HIS | HD1 | 11.363 |
159 | HIS | HE2 | 12.928 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 887 | 835 | 94.1 |
13C chemical shifts | 661 | 465 | 70.3 |
15N chemical shifts | 159 | 135 | 84.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 302 | 275 | 91.1 |
13C chemical shifts | 290 | 139 | 47.9 |
15N chemical shifts | 138 | 119 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 585 | 560 | 95.7 |
13C chemical shifts | 371 | 326 | 87.9 |
15N chemical shifts | 21 | 16 | 76.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 65 | 100.0 |
13C chemical shifts | 65 | 65 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 93 | 96.9 |
13C chemical shifts | 94 | 59 | 62.8 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--50-------60--------70--------80--------90-------100-------110-------120-------130-------140------- GSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG ||||||| ||||||||||| || ||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..KWEDFFR.SRITETFGKYQ.SP.DGKHYGIDFALPKGTPIKAPTNGKVTRIFNN.LGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSG 150-------160-------170-------180-------190-- NTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL || | |||||||||||||||||||||||||||||||||||||||| NT.I.TTGAHLHFQRMKGGVGNAYAEDPKPFIDQLPDGERSLYDL