Solution structure of the catalytic domain of zoocin A
MRGSHHHHHH GSATYTRPLD TGNITTGFNG YPGHVGVDYA VPVGTPVRAV ANGTVKFAGN GANHPWMLWM AGNAVLIQHA DGMHTGYAHL SKISVSTDST VKQGQIIGYT GATGQVTGPH LHFEMLPANP NWQNGFSGRI DPTGYIANAP VFNGTTPTE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.8 % (1461 of 1722) | 84.5 % (739 of 875) | 82.9 % (564 of 680) | 94.6 % (158 of 167) |
Backbone | 94.0 % (876 of 932) | 93.3 % (308 of 330) | 94.5 % (429 of 454) | 93.9 % (139 of 148) |
Sidechain | 77.0 % (713 of 926) | 79.1 % (431 of 545) | 72.7 % (263 of 362) | 100.0 % (19 of 19) |
Aromatic | 24.7 % (46 of 186) | 46.2 % (43 of 93) | 0.0 % (0 of 90) | 100.0 % (3 of 3) |
Methyl | 100.0 % (162 of 162) | 100.0 % (81 of 81) | 100.0 % (81 of 81) |
1. entity 1
MRGSHHHHHH GSATYTRPLD TGNITTGFNG YPGHVGVDYA VPVGTPVRAV ANGTVKFAGN GANHPWMLWM AGNAVLIQHA DGMHTGYAHL SKISVSTDST VKQGQIIGYT GATGQVTGPH LHFEMLPANP NWQNGFSGRI DPTGYIANAP VFNGTTPTESolvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.0 mM [U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | potassium phosphate | natural abundance | 10 mM | |
8 | protein | [U-90% 15N] | 1.0 mM | |
9 | sodium azide | natural abundance | 0.1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | na | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | na | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | na | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | na | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.0 mM [U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | potassium phosphate | natural abundance | 10 mM | |
8 | protein | [U-90% 15N] | 1.0 mM | |
9 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.0 mM [U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | potassium phosphate | natural abundance | 10 mM | |
8 | protein | [U-90% 15N] | 1.0 mM | |
9 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 1.1 mM [U-95% 13C; U-90% 15N] Protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-95% 13C; U-90% 15N] | 1.1 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.1 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 297 K, pH 5.6, Details 10 mM potassium phosphate, 0.1 mM sodium azide, 0.5 mM [U-95% 13C; U-90% 15N] protein, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | potassium phosphate | natural abundance | 10 mM | |
5 | protein | [U-95% 13C; U-90% 15N] | 0.5 mM | |
6 | sodium azide | natural abundance | 0.1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30139_5kvp.nef |
Input source #2: Coordindates | 5kvp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:34:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:38:ASP:OD1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:38:ASP:OD2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:122:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
2:1:ZN:ZN | 3:1:UNL:O | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | UNL | Unknown ligand | None |
C | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRGSHHHHHHGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST -------110-------120-------130-------140-------150--------- VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 159 | 0 | 0 | 100.0 |
Content subtype: combined_30139_5kvp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .RG......HGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST -------110-------120-------130-------140-------150--------- VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
23 | ASN | CG | 177.08 |
29 | ASN | CG | 177.01 |
52 | ASN | CG | 176.26 |
60 | ASN | CG | 177.2 |
63 | ASN | CG | 177.33 |
73 | ASN | CG | 176.3 |
78 | GLN | CD | 179.81 |
79 | HIS | HD1 | 10.99 |
79 | HIS | ND1 | 165.0 |
103 | GLN | CD | 180.0 |
105 | GLN | CD | 179.45 |
115 | GLN | CD | 179.7 |
129 | ASN | CG | 177.78 |
131 | ASN | CG | 177.34 |
133 | GLN | CD | 180.65 |
134 | ASN | CG | 178.6 |
148 | ASN | CG | 177.67 |
153 | ASN | CG | 177.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 875 | 727 | 83.1 |
13C chemical shifts | 680 | 559 | 82.2 |
15N chemical shifts | 171 | 159 | 93.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 330 | 309 | 93.6 |
13C chemical shifts | 318 | 301 | 94.7 |
15N chemical shifts | 148 | 137 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 545 | 418 | 76.7 |
13C chemical shifts | 362 | 258 | 71.3 |
15N chemical shifts | 23 | 22 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 86 | 84 | 97.7 |
13C chemical shifts | 86 | 83 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 93 | 37 | 39.8 |
13C chemical shifts | 90 | 0 | 0.0 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| ...........SATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLW.AGNAVLIQHADGMHTGYAHLSKISVSTDST -------110-------120-------130-------140-------150--------- VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRGSHHHHHHGSATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ............ATYTRPLDTGNITTGFNGYPGHVGVDYAVPVGTPVRAVANGTVKFAGNGANHPWMLWMAGNAVLIQHADGMHTGYAHLSKISVSTDST --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--------- VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTTPTE |||||||||||||||||||||||||||||||||||||||||||||||||||||||| VKQGQIIGYTGATGQVTGPHLHFEMLPANPNWQNGFSGRIDPTGYIANAPVFNGTT -------110-------120-------130-------140-------150------