The solution NMR structure for the PqqD truncation of Methylobacterium extorquens PqqCD representing a functional and stand-alone ribosomally synthesized and post-translational modified (RiPP) recognition element (RRE)
MEPTAFSGSD VPRLPRGVRL RFDEVRNKHV LLAPERTFDL DDNAVAVLKL VDGRNTVSQI AQILGQTYDA DPAIIEADIL PMLAGLAQKR VLER
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.1 % (994 of 1079) | 90.6 % (508 of 561) | 94.1 % (398 of 423) | 92.6 % (88 of 95) |
Backbone | 97.1 % (536 of 552) | 96.3 % (180 of 187) | 97.1 % (269 of 277) | 98.9 % (87 of 88) |
Sidechain | 88.5 % (545 of 616) | 87.7 % (328 of 374) | 91.9 % (216 of 235) | 14.3 % (1 of 7) |
Aromatic | 71.4 % (30 of 42) | 81.0 % (17 of 21) | 61.9 % (13 of 21) | |
Methyl | 92.4 % (122 of 132) | 92.4 % (61 of 66) | 92.4 % (61 of 66) |
1. entity 1
MEPTAFSGSD VPRLPRGVRL RFDEVRNKHV LLAPERTFDL DDNAVAVLKL VDGRNTVSQI AQILGQTYDA DPAIIEADIL PMLAGLAQKR VLERSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 900 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 900 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 900 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 850 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 900 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Bruker AvanceIII - 900 MHz 5 mm TCI CryoProbes including shielded z-gradient
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 4.6 mg/mL [U-13C; U-15N] PqqD, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PqqD | [U-13C; U-15N] | 4.6 mg/mL | |
2 | potassium phosphate | natural abundance | 25 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30153_5sxy.nef |
Input source #2: Coordindates | 5sxy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_30153_5sxy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 561 | 525 | 93.6 |
13C chemical shifts | 423 | 405 | 95.7 |
15N chemical shifts | 104 | 87 | 83.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 187 | 186 | 99.5 |
13C chemical shifts | 188 | 186 | 98.9 |
15N chemical shifts | 88 | 87 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 374 | 339 | 90.6 |
13C chemical shifts | 235 | 219 | 93.2 |
15N chemical shifts | 16 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 61 | 89.7 |
13C chemical shifts | 68 | 61 | 89.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 21 | 17 | 81.0 |
13C chemical shifts | 21 | 13 | 61.9 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- MEPTAFSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....FSGSDVPRLPRGVRLRFDEVRNKHVLLAPERTFDLDDNAVAVLKLVDGRNTVSQIAQILGQTYDADPAIIEADILPMLAGLAQKRVLER