NMR structure of apo-PS1
SEFEKLRQTG DELVQAFQRL REIFDKGDDD SLEQVLEEIE ELIQKHRQLF DNRQEAADTE AAKQGDQWVQ LFQRFREAID KGDKDSLEQL LEELEQALQK IRELAEKKN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.5 % (1131 of 1338) | 90.7 % (646 of 712) | 74.4 % (372 of 500) | 89.7 % (113 of 126) |
Backbone | 78.1 % (511 of 654) | 90.5 % (201 of 222) | 66.3 % (214 of 323) | 88.1 % (96 of 109) |
Sidechain | 91.4 % (721 of 789) | 90.8 % (445 of 490) | 91.8 % (259 of 282) | 100.0 % (17 of 17) |
Aromatic | 69.7 % (53 of 76) | 78.9 % (30 of 38) | 59.5 % (22 of 37) | 100.0 % (1 of 1) |
Methyl | 97.2 % (105 of 108) | 94.4 % (51 of 54) | 100.0 % (54 of 54) |
1. PS1
SEFEKLRQTG DELVQAFQRL REIFDKGDDD SLEQVLEEIE ELIQKHRQLF DNRQEAADTE AAKQGDQWVQ LFQRFREAID KGDKDSLEQL LEELEQALQK IRELAEKKNSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM U-100% 15N; 10% 13C] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | apo-PS1 | U-100% 15N; 10% 13C] | 780 uM | |
7 | NaPi | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 50 mM | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM U-100% 15N; 10% 13C] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | apo-PS1 | U-100% 15N; 10% 13C] | 780 uM | |
7 | NaPi | natural abundance | 100 mM | |
8 | NaCl | natural abundance | 50 mM | |
9 | H2O | natural abundance | 95 % | |
10 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker AvanceII - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 780 uM [U-100% 13C; U-100% 15N] apo-PS1, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-PS1 | [U-100% 13C; U-100% 15N] | 780 uM | |
2 | NaPi | natural abundance | 100 mM | |
3 | NaCl | natural abundance | 50 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30185_5tgw.nef |
Input source #2: Coordindates | 5tgw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK --------- IRELAEKKN ||||||||| IRELAEKKN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 109 | 0 | 0 | 100.0 |
Content subtype: combined_30185_5tgw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....KLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK --------- IRELAEKKN ||||||||| IRELAEKKN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
46 | HIS | HD1 | 7.258 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 712 | 673 | 94.5 |
13C chemical shifts | 500 | 361 | 72.2 |
15N chemical shifts | 134 | 108 | 80.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 208 | 93.7 |
13C chemical shifts | 218 | 102 | 46.8 |
15N chemical shifts | 109 | 90 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 490 | 465 | 94.9 |
13C chemical shifts | 282 | 259 | 91.8 |
15N chemical shifts | 25 | 18 | 72.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 54 | 100.0 |
13C chemical shifts | 54 | 54 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 33 | 86.8 |
13C chemical shifts | 37 | 22 | 59.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK |||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| .......QTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFD...............QWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- IRELAEKKN |||||| IRELAE ------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SEFEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK |||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| ..FEKLRQTGDELVQAFQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQ..ADTEAAKQGDQWVQLFQRFREAIDKGDKDSLEQLLEELEQALQK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- IRELAEKKN ||||||| IRELAEK -------