Solution structure of apo ArCP from yersiniabactin synthetase
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.5 % (850 of 1006) | 79.2 % (419 of 529) | 91.6 % (351 of 383) | 85.1 % (80 of 94) |
Backbone | 95.5 % (464 of 486) | 93.9 % (154 of 164) | 96.3 % (234 of 243) | 96.2 % (76 of 79) |
Sidechain | 77.3 % (463 of 599) | 72.6 % (265 of 365) | 88.6 % (194 of 219) | 26.7 % (4 of 15) |
Aromatic | 69.5 % (57 of 82) | 70.7 % (29 of 41) | 65.8 % (25 of 38) | 100.0 % (3 of 3) |
Methyl | 97.9 % (92 of 94) | 97.9 % (46 of 47) | 97.9 % (46 of 47) |
1. Siderophore yersiniabactin
GTDNRHAADY QQLRERLIQE LNLTPQQLHE ESNLIQAGLD SIRLMRWLHW FRKNGYRLTL RELYAAPTLA AWNQLMLSRS PESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-ArCP | [U-99% 15N] | 0.25 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
8 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-ArCP | [U-99% 15N] | 0.25 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
8 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | apo-ArCP | [U-99% 15N] | 0.25 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
8 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.80, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
8 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.4, Details 0.25 mM [U-99% 13C; U-99% 15N] apo-ArCP, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | apo-ArCP | [U-99% 13C; U-99% 15N] | 0.25 mM | |
8 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30199_5ttb.nef |
Input source #2: Coordindates | 5ttb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------20--------30--------40--------50--------60--------70--------80--------90--- GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE --------10--------20--------30--------40--------50--------60--------70--------80--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 82 | 0 | 0 | 100.0 |
Content subtype: combined_30199_5ttb.nef
Assigned chemical shifts
-------20--------30--------40--------50--------60--------70--------80--------90--- GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE ||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| ..DNRHAADYQQLRERLIQELNLTPQQLH.ESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 529 | 416 | 78.6 |
13C chemical shifts | 383 | 349 | 91.1 |
15N chemical shifts | 103 | 79 | 76.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 154 | 93.9 |
13C chemical shifts | 164 | 157 | 95.7 |
15N chemical shifts | 79 | 76 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 365 | 262 | 71.8 |
13C chemical shifts | 219 | 192 | 87.7 |
15N chemical shifts | 24 | 3 | 12.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 48 | 98.0 |
13C chemical shifts | 49 | 48 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 29 | 70.7 |
13C chemical shifts | 38 | 25 | 65.8 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
-------20--------30--------40--------50--------60--------70--------80--------90--- GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE |||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| ...NRHAADYQQLRERLIQELNLTPQQLH.ESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Dihedral angle restraints
-------20--------30--------40--------50--------60--------70--------80--------90--- GTDNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || ...NRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDSIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSR.PE