Sparse-restraint solution NMR structure of micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4 refined by restrained Rosetta
MSWMQNLKNY QHLRDPSEYM SQVYGDPLAY LQETTKFVTE REYYEDFGYG ECFNSTESEV QCELITGEFD PKLLPYDKRL AWHFKEFCYK TSAHGIPMIG EAPLEHHHHH H
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 41.6 % (561 of 1348) | 22.1 % (155 of 702) | 58.6 % (311 of 531) | 82.6 % (95 of 115) |
Backbone | 74.8 % (489 of 654) | 47.3 % (105 of 222) | 88.7 % (290 of 327) | 89.5 % (94 of 105) |
Sidechain | 20.9 % (167 of 799) | 10.6 % (51 of 480) | 37.2 % (115 of 309) | 10.0 % (1 of 10) |
Aromatic | 6.3 % (12 of 192) | 6.3 % (6 of 96) | 5.3 % (5 of 94) | 50.0 % (1 of 2) |
Methyl | 20.0 % (16 of 80) | 15.0 % (6 of 40) | 25.0 % (10 of 40) |
1. entity 1
MSWMQNLKNY QHLRDPSEYM SQVYGDPLAY LQETTKFVTE REYYEDFGYG ECFNSTESEV QCELITGEFD PKLLPYDKRL AWHFKEFCYK TSAHGIPMIG EAPLEHHHHH HSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8, Details 1.5 mM [U-13C; U-15N; U-2H] micelle-solubilized cytosolic amino terminal domain of C. elegans mechanosensory ion channel MEC-4, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Degenerin mec-4 | [U-13C; U-15N; U-2H] | 1.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_30200_5ttt.nef |
Input source #2: Coordindates | 5ttt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRLAWHFKEFCYKTSAHGIPMIG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRLAWHFKEFCYKTSAHGIPMIG -------110- EAPLEHHHHHH ||||||||||| EAPLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 111 | 0 | 0 | 100.0 |
Content subtype: combined_30200_5ttt.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRLAWHFKEFCYKTSAHGIPMIG |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| ..WMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTE..YYEDFGYGECFNSTESEVQCELITGEFDPKLLPY.KRLAWHFKEFCYKTSAHGIPMIG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110- EAPLEHHHHHH |||||| EAPLEH ------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 531 | 287 | 54.0 |
1H chemical shifts | 702 | 91 | 13.0 |
15N chemical shifts | 118 | 91 | 77.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 222 | 194 | 87.4 |
1H chemical shifts | 222 | 91 | 41.0 |
15N chemical shifts | 105 | 91 | 86.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 309 | 93 | 30.1 |
1H chemical shifts | 480 | 0 | 0.0 |
15N chemical shifts | 13 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 44 | 4 | 9.1 |
1H chemical shifts | 44 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 94 | 0 | 0.0 |
1H chemical shifts | 96 | 0 | 0.0 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSWMQNLKNYQHLRDPSEYMSQVYGDPLAYLQETTKFVTEREYYEDFGYGECFNSTESEVQCELITGEFDPKLLPYDKRLAWHFKEFCYKTSAHGIPMIG ||||||| | | | | |||||| |||| | |||||||||||||||||| || ||||||| || | ||||||||| | | ||| ....QNLKNYQ.L.D.S.Y.SQVYGD.LAYL.E...FVTEREYYEDFGYGECFN..ES....ELITGEF...LL....R..WHFKEFCYK...H.I.MIG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110- EAPLEHHHHHH || EA --
Dihedral angle restraints